Details |
SIT2_D_OG_CNDFG-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
SIT2_D_OG_CNDFG-DRAFTUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: DRAFTUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DRAFTUUID
|
SIT2_D_OG_CNDFG-PARENTDRAFTUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: PARENTDRAFTUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARENTDRAFTUUID
|
SIT2_D_OG_CNDFG-ROOTDRAFTUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: ROOTDRAFTUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ROOTDRAFTUUID
|
SIT2_D_OG_CNDFG-SITNDEFINITIONID table field - Situation Type ID
▼
Description: Situation Type ID Field Name: SITNDEFINITIONID Data Element: SIT2_DE_ST_ID Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: SIT2_DO_ST_ID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNDEFINITIONID
|
SIT2_D_OG_CNDFG-SITNOBJECTGROUPID table field - Object Group ID
▼
Description: Object Group ID Field Name: SITNOBJECTGROUPID Data Element: SIT2_DE_OBJ_GRP_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNOBJECTGROUPID
|
SIT2_D_OG_CNDFG-SITNCNDNFILTERGROUPID table field - Condition Filter Group ID
▼
Description: Condition Filter Group ID Field Name: SITNCNDNFILTERGROUPID Data Element: SIT2_DE_CND_FILTER_GRP_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNCNDNFILTERGROUPID
|
SIT2_D_OG_CNDFG-SITNBASETEMPLATEID table field - Situation Scenario ID
▼
Description: Situation Scenario ID Field Name: SITNBASETEMPLATEID Data Element: SIT2_DE_BT_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNBASETEMPLATEID
|
SIT2_D_OG_CNDFG-SITNBASETMPLOBJECTGROUPID table field - Object Group ID
▼
Description: Object Group ID Field Name: SITNBASETMPLOBJECTGROUPID Data Element: SIT2_DE_OBJ_GRP_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNBASETMPLOBJECTGROUPID
|
SIT2_D_OG_CNDFG-SITNCNDNFILTERGROUPRANK table field - Rank for Condition Filter Group
▼
Description: Rank for Condition Filter Group Field Name: SITNCNDNFILTERGROUPRANK Data Element: SIT2_DE_CND_FILTER_GRP_RANK Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: SIT2_DO_CND_FILTER_GRP_RANK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNCNDNFILTERGROUPRANK
|
SIT2_D_OG_CNDFG-SITNINSTANCETARGETSTATUS table field - Instance Target Status
▼
Description: Instance Target Status Field Name: SITNINSTANCETARGETSTATUS Data Element: SIT2_DE_INST_TARGET_STAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNINSTANCETARGETSTATUS
|
SIT2_D_OG_CNDFG-SITNCNDNNOTIFISENABLED table field - Send Notifications for Condition
▼
Description: Send Notifications for Condition Field Name: SITNCNDNNOTIFISENABLED Data Element: SIT_DE_COND_IS_NOTIF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNCNDNNOTIFISENABLED
|
SIT2_D_OG_CNDFG-SITNCNDNFLTRGRPMESSAGEID table field - Situation Message ID
▼
Description: Situation Message ID Field Name: SITNCNDNFLTRGRPMESSAGEID Data Element: SIT2_DE_MSG_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNCNDNFLTRGRPMESSAGEID
|
SIT2_D_OG_CNDFG-SITNCNDNFLTRGRPLIFECYCLEID table field - ID of Situation Life Cycle
▼
Description: ID of Situation Life Cycle Field Name: SITNCNDNFLTRGRPLIFECYCLEID Data Element: SIT2_DE_LFCYC_ID Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: SIT2_DO_LFCYC_ID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNCNDNFLTRGRPLIFECYCLEID
|
SIT2_D_OG_CNDFG-SITNCNDNFILTERGROUPDESCRIPTION table field - Condition Filter Group Description
▼
Description: Condition Filter Group Description Field Name: SITNCNDNFILTERGROUPDESCRIPTION Data Element: SIT2_DE_CNDNFG_DESC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNCNDNFILTERGROUPDESCRIPTION
|
SIT2_D_OG_CNDFG-SITNCNDNFLTRGRPMSGSEMKEY table field - Semantic Key of Situation Message
▼
Description: Semantic Key of Situation Message Field Name: SITNCNDNFLTRGRPMSGSEMKEY Data Element: SIT2_DE_MSG_SEM_KEY Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: SIT2_DO_MSG_SEM_KEY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNCNDNFLTRGRPMSGSEMKEY
|
SIT2_D_OG_CNDFG-SITNCNDNFLTRGRPLIFECYCLESEMKEY table field - Semantic Key of Situation Life Cycle
▼
Description: Semantic Key of Situation Life Cycle Field Name: SITNCNDNFLTRGRPLIFECYCLESEMKEY Data Element: SIT2_DE_LFCYC_SEM_KEY Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: SIT2_DO_LFCYC_SEM_KEY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNCNDNFLTRGRPLIFECYCLESEMKEY
|
SIT2_D_OG_CNDFG-HASACTIVEENTITY table field - Draft - Indicator - Has active document
▼
Description: Draft - Indicator - Has active document Field Name: HASACTIVEENTITY Data Element: SDRAFT_HAS_ACTIVE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HASACTIVEENTITY
|
SIT2_D_OG_CNDFG-DRAFTENTITYCREATIONDATETIME table field - Draft Created On
▼
Description: Draft Created On Field Name: DRAFTENTITYCREATIONDATETIME Data Element: SDRAFT_CREATED_AT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DRAFTENTITYCREATIONDATETIME
|
SIT2_D_OG_CNDFG-DRAFTENTITYLASTCHANGEDATETIME table field - Draft Last Changed On
▼
Description: Draft Last Changed On Field Name: DRAFTENTITYLASTCHANGEDATETIME Data Element: SDRAFT_LAST_CHANGED_AT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DRAFTENTITYLASTCHANGEDATETIME
|
SIT2_D_OG_CNDFG-DRAFTADMINISTRATIVEDATAUUID table field - Technical ID for the Administrative Data of a Draft Document
▼
Description: Technical ID for the Administrative Data of a Draft Document Field Name: DRAFTADMINISTRATIVEDATAUUID Data Element: SDRAFT_ADMIN_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DRAFTADMINISTRATIVEDATAUUID
|
SIT2_D_OG_CNDFG-DRAFTENTITYCONSISTENCYSTATUS table field - Draft - Consistency Status
▼
Description: Draft - Consistency Status Field Name: DRAFTENTITYCONSISTENCYSTATUS Data Element: SDRAFT_CONSISTENCY_STATUS Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SDRAFT_CONSISTENCY_STATUS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DRAFTENTITYCONSISTENCYSTATUS
|
SIT2_D_OG_CNDFG-DRAFTENTITYOPERATIONCODE table field - Draft - Operation Code
▼
Description: Draft - Operation Code Field Name: DRAFTENTITYOPERATIONCODE Data Element: SDRAFT_OPERATION_CODE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SDRAFT_OPERATION_CODE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DRAFTENTITYOPERATIONCODE
|