SAP RSITN2BTOGNAVP table - Generated Table for View details in SAP
Show table
SAP RSITN2BTOGNAVP table summary Object Name: RSITN2BTOGNAVP Dictionary Type: Table viewDescription: Generated Table for View
Field list for RSITN2BTOGNAVP table on an S/4 SAP system
Details
RSITN2BTOGNAVP-SITNBASETEMPLATEID table field - Situation Scenario ID
▼
Description: Situation Scenario ID Field Name: SITNBASETEMPLATEID Data Element: SIT2_DE_BT_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNBASETEMPLATEID
RSITN2BTOGNAVP-SITNBASETMPLOBJECTGROUPID table field - Object Group ID
▼
Description: Object Group ID Field Name: SITNBASETMPLOBJECTGROUPID Data Element: SIT2_DE_OBJ_GRP_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNBASETMPLOBJECTGROUPID
RSITN2BTOGNAVP-SITNNAVIGATIONTYPE table field - Navigation Type
▼
Description: Navigation Type Field Name: SITNNAVIGATIONTYPE Data Element: SIT2_DE_NAVIGATION_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNNAVIGATIONTYPE
RSITN2BTOGNAVP-SITNNAVGNPARAMNAME table field - Name of Navigation Parameter
▼
Description: Name of Navigation Parameter Field Name: SITNNAVGNPARAMNAME Data Element: SIT2_DE_NAVGN_PARAM_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNNAVGNPARAMNAME
RSITN2BTOGNAVP-SITNNAVGNPARAMVALUETYPE table field - Value Type of Navigation Parameter
▼
Description: Value Type of Navigation Parameter Field Name: SITNNAVGNPARAMVALUETYPE Data Element: SIT2_DE_NAVGN_PARAM_VALUE_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNNAVGNPARAMVALUETYPE
RSITN2BTOGNAVP-SITNNAVGNPARAMDYNVALUESOURCE table field - Source Object Type of Navigation Parameter
▼
Description: Source Object Type of Navigation Parameter Field Name: SITNNAVGNPARAMDYNVALUESOURCE Data Element: SIT2_DE_NAVGN_PARAM_SOURCE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNNAVGNPARAMDYNVALUESOURCE
RSITN2BTOGNAVP-SITNNAVGNPARAMDYNFIELDNAME table field - Name of Navigation Parameter
▼
Description: Name of Navigation Parameter Field Name: SITNNAVGNPARAMDYNFIELDNAME Data Element: SIT2_DE_NAVGN_PARAM_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNNAVGNPARAMDYNFIELDNAME
RSITN2BTOGNAVP-SITNNAVGNPARAMFIXEDVALUE table field - Fixed Value of Navigation Parameter
▼
Description: Fixed Value of Navigation Parameter Field Name: SITNNAVGNPARAMFIXEDVALUE Data Element: SIT2_DE_NAVGN_PARAM_VALUE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SITNNAVGNPARAMFIXEDVALUE
Search SAP tables