Details |
QLTYCERTSPEC-INSPECTIONLOT table field - Inspection Lot Number
▼
Description: Inspection Lot Number Field Name: INSPECTIONLOT Data Element: QPLOS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: QLS AppClass: SHLP: QALS SHLP Field: PRUEFLOS ConvExit: See all SAP tables containing field INSPECTIONLOT
|
QLTYCERTSPEC-INSPECTIONPARTIALLOT table field - Partial Lot Number
▼
Description: Partial Lot Number Field Name: INSPECTIONPARTIALLOT Data Element: QTLOS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: QTL AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONPARTIALLOT
|
QLTYCERTSPEC-INSPECTIONPLANOPERATIONINTERNA table field - Current Node Number from Order Counter
▼
Description: Current Node Number from Order Counter Field Name: INSPECTIONPLANOPERATIONINTERNA Data Element: QLFNKN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: QOPER AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONPLANOPERATIONINTERNA
|
QLTYCERTSPEC-MATERIAL table field - Material Number
▼
Description: Material Number Field Name: MATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field MATERIAL
|
QLTYCERTSPEC-BATCH table field - Batch Number
▼
Description: Batch Number Field Name: BATCH Data Element: CHARG_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: CHA AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BATCH
|
QLTYCERTSPEC-INSPCHARCPRTLSMPL table field - Number of the Partial Sample
▼
Description: Number of the Partial Sample Field Name: INSPCHARCPRTLSMPL Data Element: QPHYSPROBE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPCHARCPRTLSMPL
|
QLTYCERTSPEC-INSPECTIONCHARACTERISTICSTATUS table field - Specification Record Status
▼
Description: Specification Record Status Field Name: INSPECTIONCHARACTERISTICSTATUS Data Element: QSTATUS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONCHARACTERISTICSTATUS
|
QLTYCERTSPEC-INSPCHARACTERISTICSTATUSTEXT table field - Short Text
▼
Description: Short Text Field Name: INSPCHARACTERISTICSTATUSTEXT Data Element: QKURZTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPCHARACTERISTICSTATUSTEXT
|
QLTYCERTSPEC-INSPSPECISQUANTITATIVE table field - Quantitative Characteristic
▼
Description: Quantitative Characteristic Field Name: INSPSPECISQUANTITATIVE Data Element: QKZQUNMK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISQUANTITATIVE
|
QLTYCERTSPEC-INSPSPECISMEASUREDVALUERQD table field - Measured Values Must Be Recorded
▼
Description: Measured Values Must Be Recorded Field Name: INSPSPECISMEASUREDVALUERQD Data Element: QKZQUMK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISMEASUREDVALUERQD
|
QLTYCERTSPEC-INSPSPECISSELECTEDSETREQUIRED table field - Reference to Characteristic Attribute Required
▼
Description: Reference to Characteristic Attribute Required Field Name: INSPSPECISSELECTEDSETREQUIRED Data Element: QKZPKAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISSELECTEDSETREQUIRED
|
QLTYCERTSPEC-INSPSPECUPPERLIMIT table field - Upper Specification Limit
▼
Description: Upper Specification Limit Field Name: INSPSPECUPPERLIMIT Data Element: QKZTOLOB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECUPPERLIMIT
|
QLTYCERTSPEC-INSPSPECLOWERLIMIT table field - Lower Specification Limit
▼
Description: Lower Specification Limit Field Name: INSPSPECLOWERLIMIT Data Element: QKZTOLUN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECLOWERLIMIT
|
QLTYCERTSPEC-INSPCHARCSCOPELIMITATION table field - Inspection Scope
▼
Description: Inspection Scope Field Name: INSPCHARCSCOPELIMITATION Data Element: QPUMFKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPCHARCSCOPELIMITATION
|
QLTYCERTSPEC-INSPSPECISLONGTERMINSPECTION table field - Long-Term Inspection
▼
Description: Long-Term Inspection Field Name: INSPSPECISLONGTERMINSPECTION Data Element: QLZEITKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISLONGTERMINSPECTION
|
QLTYCERTSPEC-INSPSPECRECORDINGTYPE table field - Recording Type
▼
Description: Recording Type Field Name: INSPSPECRECORDINGTYPE Data Element: QESTUKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECRECORDINGTYPE
|
QLTYCERTSPEC-INSPRESULTISDOCUMENTATIONRQD table field - Documentation Required for Inspection Results
▼
Description: Documentation Required for Inspection Results Field Name: INSPRESULTISDOCUMENTATIONRQD Data Element: QDOKUKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRESULTISDOCUMENTATIONRQD
|
QLTYCERTSPEC-INSPSPECCHARCCATEGORY table field - Characteristic Category
▼
Description: Characteristic Category Field Name: INSPSPECCHARCCATEGORY Data Element: QRZWANG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECCHARCCATEGORY
|
QLTYCERTSPEC-INSPSPECISDESTRUCTIVE table field - Destructive Inspection
▼
Description: Destructive Inspection Field Name: INSPSPECISDESTRUCTIVE Data Element: QKZDESTROY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISDESTRUCTIVE
|
QLTYCERTSPEC-INSPSPECRESULTCALCULATION table field - Calculated Characteristic
▼
Description: Calculated Characteristic Field Name: INSPSPECRESULTCALCULATION Data Element: QKZFORMEL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECRESULTCALCULATION
|
QLTYCERTSPEC-INSPSPECISSAMPLINGPROCEDRQD table field - Sampling Procedure Is Required
▼
Description: Sampling Procedure Is Required Field Name: INSPSPECISSAMPLINGPROCEDRQD Data Element: QSTICHPR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISSAMPLINGPROCEDRQD
|
QLTYCERTSPEC-INSPSPECISSCRAPRELEVANT table field - Characteristic Relevant for Quality Score and Scrap Share
▼
Description: Characteristic Relevant for Quality Score and Scrap Share Field Name: INSPSPECISSCRAPRELEVANT Data Element: QAUSSLOS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISSCRAPRELEVANT
|
QLTYCERTSPEC-INSPSPECISDEFECTRECORDINGRQD table field - Recording the Number of Defects
▼
Description: Recording the Number of Defects Field Name: INSPSPECISDEFECTRECORDINGRQD Data Element: QBFHLZHL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISDEFECTRECORDINGRQD
|
QLTYCERTSPEC-INSPSPECISDEFECTSRECGAUTOMATIC table field - Defects Recording Automatically Called Up
▼
Description: Defects Recording Automatically Called Up Field Name: INSPSPECISDEFECTSRECGAUTOMATIC Data Element: QFEHLREC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISDEFECTSRECGAUTOMATIC
|
QLTYCERTSPEC-INSPSPECISCHGDOCREQUIRED table field - Create Change Documents During Results Recording
▼
Description: Create Change Documents During Results Recording Field Name: INSPSPECISCHGDOCREQUIRED Data Element: QKZAENBEL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECISCHGDOCREQUIRED
|
QLTYCERTSPEC-INSPECTIONMETHODPLANT table field - Plant
▼
Description: Plant Field Name: INSPECTIONMETHODPLANT Data Element: WERKS_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field INSPECTIONMETHODPLANT
|
QLTYCERTSPEC-INSPECTIONMETHOD table field - Inspection Method
▼
Description: Inspection Method Field Name: INSPECTIONMETHOD Data Element: QPMETHODE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PMT AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONMETHOD
|
QLTYCERTSPEC-INSPECTIONMETHODVERSION table field - Version Number of Inspection Method
▼
Description: Version Number of Inspection Method Field Name: INSPECTIONMETHODVERSION Data Element: QVERSNRPM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONMETHODVERSION
|
QLTYCERTSPEC-INSPECTIONMETHODTEXT table field - Short Text for Inspection Method
▼
Description: Short Text for Inspection Method Field Name: INSPECTIONMETHODTEXT Data Element: QTXTMETHOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONMETHODTEXT
|
QLTYCERTSPEC-INSPMETHODHASLONGTEXT table field - Long Text Exists for the Inspection Method
▼
Description: Long Text Exists for the Inspection Method Field Name: INSPMETHODHASLONGTEXT Data Element: QLTEXTMT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPMETHODHASLONGTEXT
|
QLTYCERTSPEC-INSPSPECIMPORTANCECODE table field - Weighting of Characteristic
▼
Description: Weighting of Characteristic Field Name: INSPSPECIMPORTANCECODE Data Element: QMERKGEW Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECIMPORTANCECODE
|
QLTYCERTSPEC-INSPECTIONSPECIFICATIONPLANT table field - Plant
▼
Description: Plant Field Name: INSPECTIONSPECIFICATIONPLANT Data Element: QWERKS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONPLANT
|
QLTYCERTSPEC-INSPECTIONSPECIFICATION table field - Master Inspection Characteristic
▼
Description: Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATION Data Element: QMERKNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PMK AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATION
|
QLTYCERTSPEC-INSPECTIONSPECIFICATIONVERSION table field - Version Number of Master Inspection Characteristic
▼
Description: Version Number of Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONVERSION Data Element: QVERSNRMK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONVERSION
|
QLTYCERTSPEC-INSPECTIONSPECIFICATIONTEXT table field - Short Text for the Inspection Characteristic
▼
Description: Short Text for the Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONTEXT Data Element: QMKKURZTXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONTEXT
|
QLTYCERTSPEC-INSPSPECINFORMATIONFIELD1 table field - Text Line for Additional Information
▼
Description: Text Line for Additional Information Field Name: INSPSPECINFORMATIONFIELD1 Data Element: QTXT10 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECINFORMATIONFIELD1
|
QLTYCERTSPEC-INSPSPECINFORMATIONFIELD2 table field - Text Line for Additional Information
▼
Description: Text Line for Additional Information Field Name: INSPSPECINFORMATIONFIELD2 Data Element: QTXT20 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECINFORMATIONFIELD2
|
QLTYCERTSPEC-INSPSPECINFORMATIONFIELD3 table field - Text Line for Additional Information
▼
Description: Text Line for Additional Information Field Name: INSPSPECINFORMATIONFIELD3 Data Element: QTXT40 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECINFORMATIONFIELD3
|
QLTYCERTSPEC-SELECTEDCODESET table field - Assigned Code Group or Selected Set
▼
Description: Assigned Code Group or Selected Set Field Name: SELECTEDCODESET Data Element: QCGRAUSW Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SELECTEDCODESET
|
QLTYCERTSPEC-SELECTEDCODESETPLANT table field - Plant of the Assigned Selected Set
▼
Description: Plant of the Assigned Selected Set Field Name: SELECTEDCODESETPLANT Data Element: QWERKAUSW Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SELECTEDCODESETPLANT
|
QLTYCERTSPEC-SELECTEDCODESETTEXT table field - Short Text for Code Group/Selected Set
▼
Description: Short Text for Code Group/Selected Set Field Name: SELECTEDCODESETTEXT Data Element: QTXT_GROUP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SELECTEDCODESETTEXT
|
QLTYCERTSPEC-INSPSPECADDITIONALCATALOGTEXT table field - Short Text for the Catalog
▼
Description: Short Text for the Catalog Field Name: INSPSPECADDITIONALCATALOGTEXT Data Element: QTXTCATALG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECADDITIONALCATALOGTEXT
|
QLTYCERTSPEC-INSPSPECDECIMALPLACES table field - Number of Places to the Right of a Decimal Point (Accuracy)
▼
Description: Number of Places to the Right of a Decimal Point (Accuracy) Field Name: INSPSPECDECIMALPLACES Data Element: QSTELLEN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECDECIMALPLACES
|
QLTYCERTSPEC-INSPECTIONSPECIFICATIONUNIT table field - Unit of Measurement
▼
Description: Unit of Measurement Field Name: INSPECTIONSPECIFICATIONUNIT Data Element: MSEHI Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONUNIT
|
QLTYCERTSPEC-INSPSPECFRMTDTARGETVALUE table field - Target Value for a Quantitative Characteristic
▼
Description: Target Value for a Quantitative Characteristic Field Name: INSPSPECFRMTDTARGETVALUE Data Element: QSOLLWERTC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFRMTDTARGETVALUE
|
QLTYCERTSPEC-INSPSPECFRMTDUPPERLIMIT table field - Upper Specification Limit
▼
Description: Upper Specification Limit Field Name: INSPSPECFRMTDUPPERLIMIT Data Element: QTOLOBC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFRMTDUPPERLIMIT
|
QLTYCERTSPEC-INSPSPECFRMTDLOWERLIMIT table field - Lower Specification Limit
▼
Description: Lower Specification Limit Field Name: INSPSPECFRMTDLOWERLIMIT Data Element: QTOLUNC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFRMTDLOWERLIMIT
|
QLTYCERTSPEC-INSPSPECUPPERLIMITFLT table field - Upper Specification Limit
▼
Description: Upper Specification Limit Field Name: INSPSPECUPPERLIMITFLT Data Element: QTOLOB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECUPPERLIMITFLT
|
QLTYCERTSPEC-INSPSPECLOWERLIMITFLT table field - Lower Specification Limit
▼
Description: Lower Specification Limit Field Name: INSPSPECLOWERLIMITFLT Data Element: QTOLUN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECLOWERLIMITFLT
|
QLTYCERTSPEC-INSPSPECHASACTIVECHANGE table field - Tolerance Change Is Active
▼
Description: Tolerance Change Is Active Field Name: INSPSPECHASACTIVECHANGE Data Element: QTOLERWKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASACTIVECHANGE
|
QLTYCERTSPEC-INSPSPECFRMTD1STUPPERSPECLIMIT table field - First Upper Specification Limit
▼
Description: First Upper Specification Limit Field Name: INSPSPECFRMTD1STUPPERSPECLIMIT Data Element: QGRENZO1C Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFRMTD1STUPPERSPECLIMIT
|
QLTYCERTSPEC-INSPSPECFRMTD1STLOWERSPECLIMIT table field - First Lower Specification Limit
▼
Description: First Lower Specification Limit Field Name: INSPSPECFRMTD1STLOWERSPECLIMIT Data Element: QGRENZU1C Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFRMTD1STLOWERSPECLIMIT
|
QLTYCERTSPEC-INSPSPECFRMTD2NDUPPERSPECLIMIT table field - Second Upper Specification Limit
▼
Description: Second Upper Specification Limit Field Name: INSPSPECFRMTD2NDUPPERSPECLIMIT Data Element: QGRENZO2C Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFRMTD2NDUPPERSPECLIMIT
|
QLTYCERTSPEC-INSPSPECFRMTD2NDLOWERSPECLIMIT table field - Second Lower Specification Limit
▼
Description: Second Lower Specification Limit Field Name: INSPSPECFRMTD2NDLOWERSPECLIMIT Data Element: QGRENZU2C Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFRMTD2NDLOWERSPECLIMIT
|
QLTYCERTSPEC-INSPSPECFRMTDUPRPLSBLTYLMT table field - Upper Plausibility Limit
▼
Description: Upper Plausibility Limit Field Name: INSPSPECFRMTDUPRPLSBLTYLMT Data Element: QPLAUSIOBC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFRMTDUPRPLSBLTYLMT
|
QLTYCERTSPEC-INSPSPECFRMTDLOWERPLSBLTYLMT table field - Lower Plausibility Limit
▼
Description: Lower Plausibility Limit Field Name: INSPSPECFRMTDLOWERPLSBLTYLMT Data Element: QPLAUSIUNC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECFRMTDLOWERPLSBLTYLMT
|
QLTYCERTSPEC-SAMPLINGPROCEDURE table field - Sampling Procedure in Inspection Characteristic
▼
Description: Sampling Procedure in Inspection Characteristic Field Name: SAMPLINGPROCEDURE Data Element: QSTICHVERF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SAMPLINGPROCEDURE
|
QLTYCERTSPEC-SAMPLINGPROCEDURETEXT table field - Short Text for Sampling Procedure
▼
Description: Short Text for Sampling Procedure Field Name: SAMPLINGPROCEDURETEXT Data Element: QTXTSMPPRO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SAMPLINGPROCEDURETEXT
|
QLTYCERTSPEC-INSPCHARACTERISTICSAMPLESIZE table field - Sample Size that Has to Be Inspected for a Characteristic
▼
Description: Sample Size that Has to Be Inspected for a Characteristic Field Name: INSPCHARACTERISTICSAMPLESIZE Data Element: QGESUMF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPCHARACTERISTICSAMPLESIZE
|
QLTYCERTSPEC-INSPCHARCQUANTITY table field - Quantity to Be Inspected
▼
Description: Quantity to Be Inspected Field Name: INSPCHARCQUANTITY Data Element: QPRUEFUMF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPCHARCQUANTITY
|
QLTYCERTSPEC-INSPECTIONLOTSAMPLEUNIT table field - Base Unit of Measure for Sample Unit
▼
Description: Base Unit of Measure for Sample Unit Field Name: INSPECTIONLOTSAMPLEUNIT Data Element: QPROBEMGEH Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONLOTSAMPLEUNIT
|
QLTYCERTSPEC-INSPECTIONLOTISFULLINSPECTION table field - 100% Inspection
▼
Description: 100% Inspection Field Name: INSPECTIONLOTISFULLINSPECTION Data Element: QHPZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONLOTISFULLINSPECTION
|
QLTYCERTSPEC-INSPVALNISBYNONCONFORMINGUNITS table field - Attributive Inspection by Nonconforming Units
▼
Description: Attributive Inspection by Nonconforming Units Field Name: INSPVALNISBYNONCONFORMINGUNITS Data Element: QKZATTRFE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPVALNISBYNONCONFORMINGUNITS
|
QLTYCERTSPEC-INSPVALNISBYNUMBEROFDEFECTS table field - Attributive Inspection by Number of Defects
▼
Description: Attributive Inspection by Number of Defects Field Name: INSPVALNISBYNUMBEROFDEFECTS Data Element: QKZATTRFZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPVALNISBYNUMBEROFDEFECTS
|
QLTYCERTSPEC-INSPVALNISBYISOMETHOD table field - Variable Inspection by S-Method
▼
Description: Variable Inspection by S-Method Field Name: INSPVALNISBYISOMETHOD Data Element: QKZVARS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPVALNISBYISOMETHOD
|
QLTYCERTSPEC-INSPVALNISBYCODE table field - Valuation by Code
▼
Description: Valuation by Code Field Name: INSPVALNISBYCODE Data Element: QKZCOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPVALNISBYCODE
|
QLTYCERTSPEC-INSPVALNISMANUALLY table field - Manual Valuation
▼
Description: Manual Valuation Field Name: INSPVALNISMANUALLY Data Element: QKZMAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPVALNISMANUALLY
|
QLTYCERTSPEC-SAMPLINGPROCEDUREMLTPLSAMPLES table field - Multiple Samples
▼
Description: Multiple Samples Field Name: SAMPLINGPROCEDUREMLTPLSAMPLES Data Element: QKZUMFS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SAMPLINGPROCEDUREMLTPLSAMPLES
|
QLTYCERTSPEC-INSPVALNISBYSPECLIMITS table field - Check Against Specification Limits (k = 0)
▼
Description: Check Against Specification Limits (k = 0) Field Name: INSPVALNISBYSPECLIMITS Data Element: QKZKNULL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPVALNISBYSPECLIMITS
|
QLTYCERTSPEC-SAMPLINGPROCEDACCEPTANCECOUNT table field - Acceptance Number
▼
Description: Acceptance Number Field Name: SAMPLINGPROCEDACCEPTANCECOUNT Data Element: QANNAHMEZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SAMPLINGPROCEDACCEPTANCECOUNT
|
QLTYCERTSPEC-INSPSAMPLEREJECTIONNUMBER table field - Rejection Number
▼
Description: Rejection Number Field Name: INSPSAMPLEREJECTIONNUMBER Data Element: QRUECKWEZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSAMPLEREJECTIONNUMBER
|
QLTYCERTSPEC-INSPVALFRMTDISOMETHODFACTOR table field - K-Factor for a Variable Inspection
▼
Description: K-Factor for a Variable Inspection Field Name: INSPVALFRMTDISOMETHODFACTOR Data Element: QKFAKTORC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPVALFRMTDISOMETHODFACTOR
|
QLTYCERTSPEC-CHARCVALUEDEPENDENCY table field - Code for value dependency
▼
Description: Code for value dependency Field Name: CHARCVALUEDEPENDENCY Data Element: ATCOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHARCVALUEDEPENDENCY
|
QLTYCERTSPEC-INSPMETHODLONGTEXT table field - Text for Inspection Method
▼
Description: Text for Inspection Method Field Name: INSPMETHODLONGTEXT Data Element: INSPECTIONMETHODTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPMETHODLONGTEXT
|