Details |
PTRDGCTRPRC-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
PTRDGCTRPRC-SOURCELOTID table field - Source Lot ID
▼
Description: Source Lot ID Field Name: SOURCELOTID Data Element: /ACCGO/E_SOURCE_LOT_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOURCELOTID
|
PTRDGCTRPRC-TRADINGCONTRACTNUMBER table field - Trading Contract
▼
Description: Trading Contract Field Name: TRADINGCONTRACTNUMBER Data Element: TKONN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WKN AppClass: SHLP: WBHK SHLP Field: TKONN ConvExit: See all SAP tables containing field TRADINGCONTRACTNUMBER
|
PTRDGCTRPRC-TRADINGCONTRACTTYPE table field - Trading Contract Type
▼
Description: Trading Contract Type Field Name: TRADINGCONTRACTTYPE Data Element: TCTYP Data Type: length (Dec): 0(0) Check table: TB2BE Conversion Routine: Domain Name: MemoryID: WKA AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRADINGCONTRACTTYPE
|
PTRDGCTRPRC-TRADINGCONTRACTTYPENAME table field - Trading Contract Type Description
▼
Description: Trading Contract Type Description Field Name: TRADINGCONTRACTTYPENAME Data Element: TCTYP_BEZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRADINGCONTRACTTYPENAME
|
PTRDGCTRPRC-SIDE table field -
▼
Description: Field Name: SIDE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SIDE
|
PTRDGCTRPRC-CONTRACTSTATUS table field - Application Status of Trading Contract
▼
Description: Application Status of Trading Contract Field Name: CONTRACTSTATUS Data Element: BTBSTA Data Type: length (Dec): 0(0) Check table: TB2BA Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTRACTSTATUS
|
PTRDGCTRPRC-TRDGCONTRAPPLSTSNAME table field - Trading Contract: Name of Application Status
▼
Description: Trading Contract: Name of Application Status Field Name: TRDGCONTRAPPLSTSNAME Data Element: BTBSTA_BEZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRDGCONTRAPPLSTSNAME
|
PTRDGCTRPRC-SALESORGANIZATION table field - Sales Organization
▼
Description: Sales Organization Field Name: SALESORGANIZATION Data Element: VKORG Data Type: length (Dec): 0(0) Check table: TVKO Conversion Routine: Domain Name: MemoryID: VKO AppClass: SHLP: C_VKORG SHLP Field: VKORG ConvExit: See all SAP tables containing field SALESORGANIZATION
|
PTRDGCTRPRC-SALESORGDESCR table field - Name
▼
Description: Name Field Name: SALESORGDESCR Data Element: VTXTK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESORGDESCR
|
PTRDGCTRPRC-DISTRIBUTIONCHANNEL table field - Distribution Channel
▼
Description: Distribution Channel Field Name: DISTRIBUTIONCHANNEL Data Element: VTWEG Data Type: length (Dec): 0(0) Check table: TVKOV Conversion Routine: Domain Name: MemoryID: VTW AppClass: SHLP: C_VTWEG SHLP Field: VTWEG ConvExit: See all SAP tables containing field DISTRIBUTIONCHANNEL
|
PTRDGCTRPRC-DISTRIBUTIONCHANNELDESCR table field - Distribution Channel Description
▼
Description: Distribution Channel Description Field Name: DISTRIBUTIONCHANNELDESCR Data Element: DISTRIBUTIONCHANNELNAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DISTRIBUTIONCHANNELDESCR
|
PTRDGCTRPRC-DIVISION table field - Division
▼
Description: Division Field Name: DIVISION Data Element: SPART Data Type: length (Dec): 0(0) Check table: TVTA Conversion Routine: Domain Name: MemoryID: SPA AppClass: SHLP: C_SPART SHLP Field: SPART ConvExit: See all SAP tables containing field DIVISION
|
PTRDGCTRPRC-SALESDIVISIONDESCR table field - Name
▼
Description: Name Field Name: SALESDIVISIONDESCR Data Element: VTXTK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESDIVISIONDESCR
|
PTRDGCTRPRC-PURCHASINGORGANIZATION table field - Purchasing Organization
▼
Description: Purchasing Organization Field Name: PURCHASINGORGANIZATION Data Element: EKORG Data Type: length (Dec): 0(0) Check table: T024E Conversion Routine: Domain Name: MemoryID: EKO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGORGANIZATION
|
PTRDGCTRPRC-PURCHASINGORGDESCR table field - Description of purchasing organization
▼
Description: Description of purchasing organization Field Name: PURCHASINGORGDESCR Data Element: EKOTX Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGORGDESCR
|
PTRDGCTRPRC-PURCHASINGGROUP table field - Purchasing Group
▼
Description: Purchasing Group Field Name: PURCHASINGGROUP Data Element: EKGRP Data Type: length (Dec): 0(0) Check table: T024 Conversion Routine: Domain Name: MemoryID: EKG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGGROUP
|
PTRDGCTRPRC-PURCHASINGGROUPDESCR table field - Purchasing Group Name
▼
Description: Purchasing Group Name Field Name: PURCHASINGGROUPDESCR Data Element: MM_A_PURG_GRP_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGGROUPDESCR
|
PTRDGCTRPRC-TRADINGCONTRACTEXTERNALID table field - External Identifier in Trading Contract
▼
Description: External Identifier in Trading Contract Field Name: TRADINGCONTRACTEXTERNALID Data Element: TKONN_EX Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WKN_EX AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRADINGCONTRACTEXTERNALID
|
PTRDGCTRPRC-CONTRACTPLANT table field - Plant
▼
Description: Plant Field Name: CONTRACTPLANT Data Element: WERKS_D Data Type: length (Dec): 0(0) Check table: T001W Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field CONTRACTPLANT
|
PTRDGCTRPRC-CONTRACTMATERIAL table field - Material Number
▼
Description: Material Number Field Name: CONTRACTMATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field CONTRACTMATERIAL
|
PTRDGCTRPRC-TRADINGCONTRACTITEM table field - Item Number of Trading Contract
▼
Description: Item Number of Trading Contract Field Name: TRADINGCONTRACTITEM Data Element: TPOSN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WKP AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRADINGCONTRACTITEM
|
PTRDGCTRPRC-DOCUMENTDATE table field - Record Created On
▼
Description: Record Created On Field Name: DOCUMENTDATE Data Element: ERDAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTDATE
|
PTRDGCTRPRC-PERSONRESPONSIBLE table field - Trading Contract: Person Responsible
▼
Description: Trading Contract: Person Responsible Field Name: PERSONRESPONSIBLE Data Element: TKSACHB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERSONRESPONSIBLE
|
PTRDGCTRPRC-PERSONRESPONSIBLENAME table field - Full Name of Person
▼
Description: Full Name of Person Field Name: PERSONRESPONSIBLENAME Data Element: AD_NAMTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERSONRESPONSIBLENAME
|
PTRDGCTRPRC-TRADINGCONTRACTCREATEDBY table field - Name of Person Responsible for Creating the Object
▼
Description: Name of Person Responsible for Creating the Object Field Name: TRADINGCONTRACTCREATEDBY Data Element: ERNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRADINGCONTRACTCREATEDBY
|
PTRDGCTRPRC-TRADINGCONTRACTCREATEDBYNAME table field - Full Name of Person
▼
Description: Full Name of Person Field Name: TRADINGCONTRACTCREATEDBYNAME Data Element: AD_NAMTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRADINGCONTRACTCREATEDBYNAME
|
PTRDGCTRPRC-TRADINGCONTRACTCHANGEDBY table field - Name of Person Who Changed Object
▼
Description: Name of Person Who Changed Object Field Name: TRADINGCONTRACTCHANGEDBY Data Element: AENAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRADINGCONTRACTCHANGEDBY
|
PTRDGCTRPRC-TRADINGCONTRACTCHANGEDBYNAME table field - Full Name of Person
▼
Description: Full Name of Person Field Name: TRADINGCONTRACTCHANGEDBYNAME Data Element: AD_NAMTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRADINGCONTRACTCHANGEDBYNAME
|
PTRDGCTRPRC-INCOTERMSCLASSIFICATIONNAME table field - Incoterms Classification Description
▼
Description: Incoterms Classification Description Field Name: INCOTERMSCLASSIFICATIONNAME Data Element: INCOTERMS_CLASSIFICATION_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INCOTERMSCLASSIFICATIONNAME
|
PTRDGCTRPRC-PRICINGAPPROACH table field - Pricing Approach
▼
Description: Pricing Approach Field Name: PRICINGAPPROACH Data Element: /ACCGO/CPE_E_PRICING_APPROACH Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRICINGAPPROACH
|
PTRDGCTRPRC-COMMODITY table field - Commodity
▼
Description: Commodity Field Name: COMMODITY Data Element: TBA_STOEFFCHEN Data Type: length (Dec): 0(0) Check table: TBAC_PHYSCOMM Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: TBAH_STOEFFCHEN SHLP Field: COMMODITY ConvExit: See all SAP tables containing field COMMODITY
|
PTRDGCTRPRC-COUNTERPARTY table field - Customer Number
▼
Description: Customer Number Field Name: COUNTERPARTY Data Element: KUNNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: KUN AppClass: SHLP: C_KUNNR SHLP Field: KUNNR ConvExit: See all SAP tables containing field COUNTERPARTY
|
PTRDGCTRPRC-INCOTERMS table field - Incoterms Part 1 Sales
▼
Description: Incoterms Part 1 Sales Field Name: INCOTERMS Data Element: WB2_INCO1_SD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INCOTERMS
|
PTRDGCTRPRC-INCOTERMSLOCATION1 table field - Incoterms Location 1
▼
Description: Incoterms Location 1 Field Name: INCOTERMSLOCATION1 Data Element: INCO2_L Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INCOTERMSLOCATION1
|
PTRDGCTRPRC-TRDGCONTRPURGINCOTERMSLOC1TEXT table field - Incoterms Location 1
▼
Description: Incoterms Location 1 Field Name: TRDGCONTRPURGINCOTERMSLOC1TEXT Data Element: INCO2_L Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRDGCONTRPURGINCOTERMSLOC1TEXT
|
PTRDGCTRPRC-TRDGCONTRSLSINCOTERMSLOC1TEXT table field - Incoterms Location 1
▼
Description: Incoterms Location 1 Field Name: TRDGCONTRSLSINCOTERMSLOC1TEXT Data Element: INCO2_L Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRDGCONTRSLSINCOTERMSLOC1TEXT
|
PTRDGCTRPRC-UOM table field - Unit of Measure of Trade Quantity
▼
Description: Unit of Measure of Trade Quantity Field Name: UOM Data Element: /ACCGO/E_CSL_TRADE_QTY_UOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field UOM
|
PTRDGCTRPRC-QUANTITY table field - Quantity in Trade UoM Send by 3PT
▼
Description: Quantity in Trade UoM Send by 3PT Field Name: QUANTITY Data Element: /ACCGO/E_CSL_TRADE_QTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field QUANTITY
|
PTRDGCTRPRC-TERMNO table field - CPE Term - Number in Formula
▼
Description: CPE Term - Number in Formula Field Name: TERMNO Data Element: CPET_TERMNO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TERMNO
|
PTRDGCTRPRC-PRICINGCONDITIONTERM table field - CPE Term - Number in Formula
▼
Description: CPE Term - Number in Formula Field Name: PRICINGCONDITIONTERM Data Element: CPET_TERMNO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRICINGCONDITIONTERM
|
PTRDGCTRPRC-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: length (Dec): 0(0) Check table: T001 Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
PTRDGCTRPRC-DERIVATIVECONTRSPECIFICATION table field - Derivative Contract Specification ID
▼
Description: Derivative Contract Specification ID Field Name: DERIVATIVECONTRSPECIFICATION Data Element: TBA_DCSID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: TBA_DCSID AppClass: SHLP: TBAH_DCSID SHLP Field: DCSID ConvExit: See all SAP tables containing field DERIVATIVECONTRSPECIFICATION
|
PTRDGCTRPRC-ACMPRICINGMARKETIDENTIFIERCODE table field - Market Identifier Code
▼
Description: Market Identifier Code Field Name: ACMPRICINGMARKETIDENTIFIERCODE Data Element: TBA_MIC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: TBA_MIC AppClass: SHLP: TBAH_MIC SHLP Field: MIC ConvExit: See all SAP tables containing field ACMPRICINGMARKETIDENTIFIERCODE
|
PTRDGCTRPRC-MATURITYKEYDATE table field - Maturity Key Date
▼
Description: Maturity Key Date Field Name: MATURITYKEYDATE Data Element: TBA_KEYDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATURITYKEYDATE
|
PTRDGCTRPRC-CONTRACTMATURITYCODE table field -
▼
Description: Field Name: CONTRACTMATURITYCODE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTRACTMATURITYCODE
|
PTRDGCTRPRC-PRCGCNDNTRADINGCONTRCURRENCY table field - Total Amount
▼
Description: Total Amount Field Name: PRCGCNDNTRADINGCONTRCURRENCY Data Element: /ACCGO/CPE_E_TOTAL_PRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRCGCNDNTRADINGCONTRCURRENCY
|
PTRDGCTRPRC-CMMDTYDEALDETEFFECTIVEFROMDATE table field - Date From
▼
Description: Date From Field Name: CMMDTYDEALDETEFFECTIVEFROMDATE Data Element: WLF_DATE_FROM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDEALDETEFFECTIVEFROMDATE
|
PTRDGCTRPRC-CMMDTYDEALDETEFFECTIVETODATE table field - Date To
▼
Description: Date To Field Name: CMMDTYDEALDETEFFECTIVETODATE Data Element: WLF_DATE_TO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDEALDETEFFECTIVETODATE
|
PTRDGCTRPRC-ACMPRCGINTENDEDPRCTYPE table field - Intended price type
▼
Description: Intended price type Field Name: ACMPRCGINTENDEDPRCTYPE Data Element: /ACCGO/E_INTENDED_PRICE_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACMPRCGINTENDEDPRCTYPE
|
PTRDGCTRPRC-ACMYOURREFERENCE table field - Your Reference
▼
Description: Your Reference Field Name: ACMYOURREFERENCE Data Element: IHREZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACMYOURREFERENCE
|
PTRDGCTRPRC-ACMCUSTOMERREFERENCE table field - Customer Reference
▼
Description: Customer Reference Field Name: ACMCUSTOMERREFERENCE Data Element: BSTKD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACMCUSTOMERREFERENCE
|