Details |
PSRTRLBALITM-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
PSRTRLBALITM-LEDGER table field - Ledger in General Ledger Accounting
▼
Description: Ledger in General Ledger Accounting Field Name: LEDGER Data Element: FINS_LEDGER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: GLN_FLEX AppClass: SHLP: FINS_LEDGER SHLP Field: RLDNR ConvExit: See all SAP tables containing field LEDGER
|
PSRTRLBALITM-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: FIS_BUKRS Data Type: length (Dec): 0(0) Check table: T001 Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
PSRTRLBALITM-FISCALYEAR table field - Fiscal Year
▼
Description: Fiscal Year Field Name: FISCALYEAR Data Element: FIS_GJAHR_NO_CONV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FISCALYEAR
|
PSRTRLBALITM-SOURCELEDGER table field - Source Ledger
▼
Description: Source Ledger Field Name: SOURCELEDGER Data Element: FINS_LEDGER_PERS Data Type: length (Dec): 0(0) Check table: FINSC_LEDGER Conversion Routine: Domain Name: MemoryID: GLN_FLEX AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOURCELEDGER
|
PSRTRLBALITM-ACCOUNTINGDOCUMENT table field - Journal Entry
▼
Description: Journal Entry Field Name: ACCOUNTINGDOCUMENT Data Element: FIS_BELNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTINGDOCUMENT
|
PSRTRLBALITM-LEDGERGLLINEITEM table field - General Ledger Journal Entry Line Item
▼
Description: General Ledger Journal Entry Line Item Field Name: LEDGERGLLINEITEM Data Element: FIS_DOCLN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LEDGERGLLINEITEM
|
PSRTRLBALITM-ACCOUNTINGDOCUMENTITEM table field - Journal Entry Posting View Item
▼
Description: Journal Entry Posting View Item Field Name: ACCOUNTINGDOCUMENTITEM Data Element: FIS_BUZEI Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BUZ AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTINGDOCUMENTITEM
|
PSRTRLBALITM-FISCALPERIOD table field - Fiscal Period
▼
Description: Fiscal Period Field Name: FISCALPERIOD Data Element: FINS_FISCALPERIOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: POPR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FISCALPERIOD
|
PSRTRLBALITM-POSTINGDATE table field - Posting Date
▼
Description: Posting Date Field Name: POSTINGDATE Data Element: FIS_BUDAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field POSTINGDATE
|
PSRTRLBALITM-DOCUMENTDATE table field - Journal Entry Date
▼
Description: Journal Entry Date Field Name: DOCUMENTDATE Data Element: FIS_BLDAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTDATE
|
PSRTRLBALITM-ISREVERSAL table field - Indicator: Item is Reversing Another Item
▼
Description: Indicator: Item is Reversing Another Item Field Name: ISREVERSAL Data Element: FINS_XREVERSING Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISREVERSAL
|
PSRTRLBALITM-ISREVERSED table field - Indicator: Item is Reversed
▼
Description: Indicator: Item is Reversed Field Name: ISREVERSED Data Element: FINS_XREVERSED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISREVERSED
|
PSRTRLBALITM-PROFITCENTER table field - Profit Center
▼
Description: Profit Center Field Name: PROFITCENTER Data Element: FIS_PRCTR Data Type: length (Dec): 0(0) Check table: CEPC Conversion Routine: Domain Name: MemoryID: PRC AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROFITCENTER
|
PSRTRLBALITM-FUNCTIONALAREA table field - Functional Area
▼
Description: Functional Area Field Name: FUNCTIONALAREA Data Element: FM_FAREA Data Type: length (Dec): 0(0) Check table: TFKB Conversion Routine: Domain Name: MemoryID: FBE AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FUNCTIONALAREA
|
PSRTRLBALITM-BUSINESSAREA table field - Business Area
▼
Description: Business Area Field Name: BUSINESSAREA Data Element: FIS_RBUSA Data Type: length (Dec): 0(0) Check table: TGSB Conversion Routine: Domain Name: MemoryID: GSB AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSAREA
|
PSRTRLBALITM-CONTROLLINGAREA table field - Controlling Area
▼
Description: Controlling Area Field Name: CONTROLLINGAREA Data Element: FIS_KOKRS Data Type: length (Dec): 0(0) Check table: TKA01 Conversion Routine: Domain Name: MemoryID: CAC AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLINGAREA
|
PSRTRLBALITM-SEGMENT table field - Segment for Segmental Reporting
▼
Description: Segment for Segmental Reporting Field Name: SEGMENT Data Element: FB_SEGMENT Data Type: length (Dec): 0(0) Check table: FAGL_SEGM Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SEGMENT
|
PSRTRLBALITM-CHARTOFACCOUNTS table field - Chart of Accounts
▼
Description: Chart of Accounts Field Name: CHARTOFACCOUNTS Data Element: FIS_KTOPL Data Type: length (Dec): 0(0) Check table: T004 Conversion Routine: Domain Name: MemoryID: KPL AppClass: SHLP: C_KTOPL SHLP Field: KTOPL ConvExit: See all SAP tables containing field CHARTOFACCOUNTS
|
PSRTRLBALITM-ALTERNATIVEGLACCOUNT table field - Alternative G/L Account Number In Company Code
▼
Description: Alternative G/L Account Number In Company Code Field Name: ALTERNATIVEGLACCOUNT Data Element: FIS_ALTERNATIVEGLACCOUNT Data Type: length (Dec): 0(0) Check table: SKA1 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ALTERNATIVEGLACCOUNT
|
PSRTRLBALITM-COUNTRYCHARTOFACCOUNTS table field - Alternative Chart of Accounts for Country/Region
▼
Description: Alternative Chart of Accounts for Country/Region Field Name: COUNTRYCHARTOFACCOUNTS Data Element: FIS_KTOP2 Data Type: length (Dec): 0(0) Check table: T004 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COUNTRYCHARTOFACCOUNTS
|
PSRTRLBALITM-GLACCOUNT table field - G/L Account
▼
Description: G/L Account Field Name: GLACCOUNT Data Element: FIS_RACCT Data Type: length (Dec): 0(0) Check table: SKB1 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GLACCOUNT
|
PSRTRLBALITM-RECONCILIATIONACCOUNTTYPE table field - Account Is Reconciliation Account
▼
Description: Account Is Reconciliation Account Field Name: RECONCILIATIONACCOUNTTYPE Data Element: MITKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECONCILIATIONACCOUNTTYPE
|
PSRTRLBALITM-SUPPLIER table field - Supplier
▼
Description: Supplier Field Name: SUPPLIER Data Element: MD_SUPPLIER Data Type: length (Dec): 0(0) Check table: LFA1 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLIER
|
PSRTRLBALITM-CUSTOMER table field - Customer Number
▼
Description: Customer Number Field Name: CUSTOMER Data Element: KUNNR Data Type: length (Dec): 0(0) Check table: KNA1 Conversion Routine: Domain Name: MemoryID: KUN AppClass: SHLP: C_KUNNR SHLP Field: KUNNR ConvExit: See all SAP tables containing field CUSTOMER
|
PSRTRLBALITM-FINANCIALACCOUNTTYPE table field - Account Type
▼
Description: Account Type Field Name: FINANCIALACCOUNTTYPE Data Element: FARP_KOART Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINANCIALACCOUNTTYPE
|
PSRTRLBALITM-SPECIALGLCODE table field - Special G/L Indicator
▼
Description: Special G/L Indicator Field Name: SPECIALGLCODE Data Element: FAC_UMSKZ Data Type: length (Dec): 0(0) Check table: T074U Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SPECIALGLCODE
|
PSRTRLBALITM-ACCOUNTINGDOCUMENTTYPE table field - Journal Entry Type
▼
Description: Journal Entry Type Field Name: ACCOUNTINGDOCUMENTTYPE Data Element: FIS_BLART Data Type: length (Dec): 0(0) Check table: T003 Conversion Routine: Domain Name: MemoryID: BAR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTINGDOCUMENTTYPE
|
PSRTRLBALITM-POSTINGKEY table field - Posting Key
▼
Description: Posting Key Field Name: POSTINGKEY Data Element: FIS_BSCHL Data Type: length (Dec): 0(0) Check table: TBSL Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field POSTINGKEY
|
PSRTRLBALITM-ACCOUNTINGDOCUMENTCATEGORY table field - Journal Entry Category
▼
Description: Journal Entry Category Field Name: ACCOUNTINGDOCUMENTCATEGORY Data Element: FIS_BSTAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTINGDOCUMENTCATEGORY
|
PSRTRLBALITM-ACCOUNTINGDOCCREATEDBYUSER table field - User that created the journal entry
▼
Description: User that created the journal entry Field Name: ACCOUNTINGDOCCREATEDBYUSER Data Element: FIS_USNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTINGDOCCREATEDBYUSER
|
PSRTRLBALITM-DEBITCREDITCODE table field - Debit/Credit Code
▼
Description: Debit/Credit Code Field Name: DEBITCREDITCODE Data Element: FIS_SHKZG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCREDITCODE
|
PSRTRLBALITM-CASHJOURNALITEMTYPE table field -
▼
Description: Field Name: CASHJOURNALITEMTYPE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CASHJOURNALITEMTYPE
|
PSRTRLBALITM-ITEMTYPE table field - Line Item Type
▼
Description: Line Item Type Field Name: ITEMTYPE Data Element: GLO_ITEM_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ITEMTYPE
|
PSRTRLBALITM-TAXCODE table field - Tax on Sales/Purchases Code
▼
Description: Tax on Sales/Purchases Code Field Name: TAXCODE Data Element: FIS_MWSKZ Data Type: length (Dec): 0(0) Check table: T007A Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAXCODE
|
PSRTRLBALITM-JRNLENTRYITEMMIGRATIONSOURCE table field - Journal Entry Item Migration Source
▼
Description: Journal Entry Item Migration Source Field Name: JRNLENTRYITEMMIGRATIONSOURCE Data Element: FIS_ACDOC_MIG_SOURCE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field JRNLENTRYITEMMIGRATIONSOURCE
|
PSRTRLBALITM-COMPANYCODECURRENCY table field - Company Code Currency
▼
Description: Company Code Currency Field Name: COMPANYCODECURRENCY Data Element: FIS_HWAER Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPANYCODECURRENCY
|
PSRTRLBALITM-CARRYFWDBALAMTINCCCRCY table field - Carry Forward Balance Amount in Company Code Currency
▼
Description: Carry Forward Balance Amount in Company Code Currency Field Name: CARRYFWDBALAMTINCCCRCY Data Element: GLO_CFWD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CARRYFWDBALAMTINCCCRCY
|
PSRTRLBALITM-DEBITCARRYFWDBALAMTINCCCRCY table field - Debit Carry Forward Balance Amount in Company Code Currency
▼
Description: Debit Carry Forward Balance Amount in Company Code Currency Field Name: DEBITCARRYFWDBALAMTINCCCRCY Data Element: GLO_DR_CFWD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCARRYFWDBALAMTINCCCRCY
|
PSRTRLBALITM-CREDITCARRYFWDBALAMTINCCCRCY table field - Credit Carry Forward Balance Amount in Company Code Currency
▼
Description: Credit Carry Forward Balance Amount in Company Code Currency Field Name: CREDITCARRYFWDBALAMTINCCCRCY Data Element: GLO_CR_CFWD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITCARRYFWDBALAMTINCCCRCY
|
PSRTRLBALITM-PREVPERIODYTDAMTINCCCRCY table field - Previous Period YTD Amount in Company Code Currency
▼
Description: Previous Period YTD Amount in Company Code Currency Field Name: PREVPERIODYTDAMTINCCCRCY Data Element: GLO_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVPERIODYTDAMTINCCCRCY
|
PSRTRLBALITM-DEBITPREVPERIODYTDAMTINCCCRCY table field - Debit Previous Period YTD Amount in Company Code Currency
▼
Description: Debit Previous Period YTD Amount in Company Code Currency Field Name: DEBITPREVPERIODYTDAMTINCCCRCY Data Element: GLO_DR_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITPREVPERIODYTDAMTINCCCRCY
|
PSRTRLBALITM-CREDITPREVPERIODYTDAMTINCCCRCY table field - Credit Previous Period YTD Amount in Company Code Currency
▼
Description: Credit Previous Period YTD Amount in Company Code Currency Field Name: CREDITPREVPERIODYTDAMTINCCCRCY Data Element: GLO_CR_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITPREVPERIODYTDAMTINCCCRCY
|
PSRTRLBALITM-STARTINGBALANCEAMTINCOCODECRCY table field - Starting Balance in Company Code Currency
▼
Description: Starting Balance in Company Code Currency Field Name: STARTINGBALANCEAMTINCOCODECRCY Data Element: FIS_START_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STARTINGBALANCEAMTINCOCODECRCY
|
PSRTRLBALITM-DEBITSTARTINGBALAMTINCCCRCY table field - Debit Starting Balance Amount in Company Code Currency
▼
Description: Debit Starting Balance Amount in Company Code Currency Field Name: DEBITSTARTINGBALAMTINCCCRCY Data Element: GLO_DR_STRT_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITSTARTINGBALAMTINCCCRCY
|
PSRTRLBALITM-CREDITSTARTINGBALAMTINCCCRCY table field - Credit Starting Balance Amount in Company Code Currency
▼
Description: Credit Starting Balance Amount in Company Code Currency Field Name: CREDITSTARTINGBALAMTINCCCRCY Data Element: GLO_CR_STRT_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITSTARTINGBALAMTINCCCRCY
|
PSRTRLBALITM-AMOUNTINCOMPANYCODECURRENCY table field - Amount in Company Code Currency
▼
Description: Amount in Company Code Currency Field Name: AMOUNTINCOMPANYCODECURRENCY Data Element: FIS_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINCOMPANYCODECURRENCY
|
PSRTRLBALITM-DEBITAMOUNTINCOCODECRCY table field - Debit Amount in Company Code Currency
▼
Description: Debit Amount in Company Code Currency Field Name: DEBITAMOUNTINCOCODECRCY Data Element: FIS_DR_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITAMOUNTINCOCODECRCY
|
PSRTRLBALITM-CREDITAMOUNTINCOCODECRCY table field - Credit Amount in Company Code Currency
▼
Description: Credit Amount in Company Code Currency Field Name: CREDITAMOUNTINCOCODECRCY Data Element: FIS_CR_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITAMOUNTINCOCODECRCY
|
PSRTRLBALITM-ENDINGBALANCEAMTINCOCODECRCY table field - Ending Balance in Company Code Currency
▼
Description: Ending Balance in Company Code Currency Field Name: ENDINGBALANCEAMTINCOCODECRCY Data Element: FIS_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENDINGBALANCEAMTINCOCODECRCY
|
PSRTRLBALITM-DEBITENDINGBALAMTINCCCRCY table field - Debit Ending Balance Amount in Company Code Currency
▼
Description: Debit Ending Balance Amount in Company Code Currency Field Name: DEBITENDINGBALAMTINCCCRCY Data Element: GLO_DR_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITENDINGBALAMTINCCCRCY
|
PSRTRLBALITM-CREDITENDINGBALAMTINCCCRCY table field - Credit Ending Balance Amount in Company Code Currency
▼
Description: Credit Ending Balance Amount in Company Code Currency Field Name: CREDITENDINGBALAMTINCCCRCY Data Element: GLO_CR_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITENDINGBALAMTINCCCRCY
|
PSRTRLBALITM-YTDAMTINLOCLCRCY table field - Year to Date Amount in Company Code Currency
▼
Description: Year to Date Amount in Company Code Currency Field Name: YTDAMTINLOCLCRCY Data Element: GLO_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YTDAMTINLOCLCRCY
|
PSRTRLBALITM-YTDDEBITAMTINCOCODECRCY table field - Debit Year to Date Amount in Company Code Currency
▼
Description: Debit Year to Date Amount in Company Code Currency Field Name: YTDDEBITAMTINCOCODECRCY Data Element: GLO_DR_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YTDDEBITAMTINCOCODECRCY
|
PSRTRLBALITM-YTDCRDTAMTINCOCODECRCY table field - Credit Year to Date Amount in Company Code Currency
▼
Description: Credit Year to Date Amount in Company Code Currency Field Name: YTDCRDTAMTINCOCODECRCY Data Element: GLO_CR_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YTDCRDTAMTINCOCODECRCY
|
PSRTRLBALITM-TRANSACTIONCURRENCY table field - Transaction Currency
▼
Description: Transaction Currency Field Name: TRANSACTIONCURRENCY Data Element: FIS_RWCUR Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSACTIONCURRENCY
|
PSRTRLBALITM-CARRYFWDBALANCEAMTINTRANSCRCY table field - Carry Forward Balance Amount in Transaction Currency
▼
Description: Carry Forward Balance Amount in Transaction Currency Field Name: CARRYFWDBALANCEAMTINTRANSCRCY Data Element: GLO_CFWD_BAL_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CARRYFWDBALANCEAMTINTRANSCRCY
|
PSRTRLBALITM-DEBITCARRYFWDBALAMTINTRANSCRCY table field - Debit Carry Forward Balance Amount in Transaction Currency
▼
Description: Debit Carry Forward Balance Amount in Transaction Currency Field Name: DEBITCARRYFWDBALAMTINTRANSCRCY Data Element: GLO_DR_CFWD_BAL_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCARRYFWDBALAMTINTRANSCRCY
|
PSRTRLBALITM-CRDTCARRYFWDBALAMTINTRANSCRCY table field - Credit Carry Forward Balance Amount in Transaction Currency
▼
Description: Credit Carry Forward Balance Amount in Transaction Currency Field Name: CRDTCARRYFWDBALAMTINTRANSCRCY Data Element: GLO_CR_CFWD_BAL_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CRDTCARRYFWDBALAMTINTRANSCRCY
|
PSRTRLBALITM-PREVPERDYTDAMOUNTINTRANSCRCY table field - Previous Period YTD Amount in Transaction Currency
▼
Description: Previous Period YTD Amount in Transaction Currency Field Name: PREVPERDYTDAMOUNTINTRANSCRCY Data Element: GLO_YTD_BAL_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVPERDYTDAMOUNTINTRANSCRCY
|
PSRTRLBALITM-DEBITPREVPERDYTDAMTINTRANSCRCY table field - Debit Previous Period YTD Amount in Transaction Currency
▼
Description: Debit Previous Period YTD Amount in Transaction Currency Field Name: DEBITPREVPERDYTDAMTINTRANSCRCY Data Element: GLO_DR_YTD_BAL_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITPREVPERDYTDAMTINTRANSCRCY
|
PSRTRLBALITM-CRDTPREVPERDYTDAMTINTRANSCRCY table field - Credit Previous Period YTD Amount in Transaction Currency
▼
Description: Credit Previous Period YTD Amount in Transaction Currency Field Name: CRDTPREVPERDYTDAMTINTRANSCRCY Data Element: GLO_CR_YTD_BAL_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CRDTPREVPERDYTDAMTINTRANSCRCY
|
PSRTRLBALITM-STARTINGBALANCEAMTINTRANSCRCY table field - Starting Balance Amount In Transaction Currency
▼
Description: Starting Balance Amount In Transaction Currency Field Name: STARTINGBALANCEAMTINTRANSCRCY Data Element: FIS_START_BAL_WSL_UI Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STARTINGBALANCEAMTINTRANSCRCY
|
PSRTRLBALITM-DEBITSTARTINGBALAMTINTRANSCRCY table field - Debit Starting Balance Amount in Transaction Currency
▼
Description: Debit Starting Balance Amount in Transaction Currency Field Name: DEBITSTARTINGBALAMTINTRANSCRCY Data Element: GLO_DR_STRT_BAL_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITSTARTINGBALAMTINTRANSCRCY
|
PSRTRLBALITM-CRDTSTARTINGBALAMTINTRANSCRCY table field - Credit Starting Balance Amount in Transaction Currency
▼
Description: Credit Starting Balance Amount in Transaction Currency Field Name: CRDTSTARTINGBALAMTINTRANSCRCY Data Element: GLO_CR_STRT_BAL_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CRDTSTARTINGBALAMTINTRANSCRCY
|
PSRTRLBALITM-AMOUNTINTRANSACTIONCURRENCY table field - Amount in Transaction Currency
▼
Description: Amount in Transaction Currency Field Name: AMOUNTINTRANSACTIONCURRENCY Data Element: FIS_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINTRANSACTIONCURRENCY
|
PSRTRLBALITM-DEBITAMOUNTINTRANSCRCY table field - Debit Amount in Transaction Currency
▼
Description: Debit Amount in Transaction Currency Field Name: DEBITAMOUNTINTRANSCRCY Data Element: FIS_DR_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITAMOUNTINTRANSCRCY
|
PSRTRLBALITM-CREDITAMOUNTINTRANSCRCY table field - Credit Amount in Transaction Currency
▼
Description: Credit Amount in Transaction Currency Field Name: CREDITAMOUNTINTRANSCRCY Data Element: FIS_CR_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITAMOUNTINTRANSCRCY
|
PSRTRLBALITM-ENDINGBALANCEAMTINTRANSCRCY table field - Ending Balance in Company Code Currency
▼
Description: Ending Balance in Company Code Currency Field Name: ENDINGBALANCEAMTINTRANSCRCY Data Element: FIS_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENDINGBALANCEAMTINTRANSCRCY
|
PSRTRLBALITM-DEBITENDINGBALAMTINTRANSCRCY table field - Debit Ending Balance Amount in Transaction Currency
▼
Description: Debit Ending Balance Amount in Transaction Currency Field Name: DEBITENDINGBALAMTINTRANSCRCY Data Element: GLO_DR_END_BAL_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITENDINGBALAMTINTRANSCRCY
|
PSRTRLBALITM-CREDITENDINGBALAMTINTRANSCRCY table field - Credit Ending Balance Amount in Transaction Currency
▼
Description: Credit Ending Balance Amount in Transaction Currency Field Name: CREDITENDINGBALAMTINTRANSCRCY Data Element: GLO_CR_END_BAL_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITENDINGBALAMTINTRANSCRCY
|
PSRTRLBALITM-YRTODTEAMTINTRANSACCRCY table field - Year to Date Amount in Company Code Currency
▼
Description: Year to Date Amount in Company Code Currency Field Name: YRTODTEAMTINTRANSACCRCY Data Element: GLO_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YRTODTEAMTINTRANSACCRCY
|
PSRTRLBALITM-YTDDEBITAMTINTRANSCRCY table field - Debit Year to Date Amount in Transaction Currency
▼
Description: Debit Year to Date Amount in Transaction Currency Field Name: YTDDEBITAMTINTRANSCRCY Data Element: GLO_DR_CYTD_BAL_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YTDDEBITAMTINTRANSCRCY
|
PSRTRLBALITM-YTDCRDTAMTINTRANSCRCY table field - Credit Year to Date Amount in Transaction Currency
▼
Description: Credit Year to Date Amount in Transaction Currency Field Name: YTDCRDTAMTINTRANSCRCY Data Element: GLO_CR_CYTD_BAL_WSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YTDCRDTAMTINTRANSCRCY
|
PSRTRLBALITM-BALANCETRANSACTIONCURRENCY table field - Balance Transaction Currency
▼
Description: Balance Transaction Currency Field Name: BALANCETRANSACTIONCURRENCY Data Element: FIS_RTCUR Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BALANCETRANSACTIONCURRENCY
|
PSRTRLBALITM-CARRYFWDBALAMTINBALTRANSCRCY table field - Carry Forward Balance Amt in Balance Transaction Crcy
▼
Description: Carry Forward Balance Amt in Balance Transaction Crcy Field Name: CARRYFWDBALAMTINBALTRANSCRCY Data Element: GLO_CFWD_BAL_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CARRYFWDBALAMTINBALTRANSCRCY
|
PSRTRLBALITM-DEBITCARRYFWDBALAMTINBLTCRCY table field - Debit Carry Forward Balance Amt in Balance Transaction Crcy
▼
Description: Debit Carry Forward Balance Amt in Balance Transaction Crcy Field Name: DEBITCARRYFWDBALAMTINBLTCRCY Data Element: GLO_DR_CFWD_BAL_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCARRYFWDBALAMTINBLTCRCY
|
PSRTRLBALITM-CRDTCARRYFWDBALAMTINBLTCRCY table field - Credit Carry Forward Balance Amt in Balance Transaction Crcy
▼
Description: Credit Carry Forward Balance Amt in Balance Transaction Crcy Field Name: CRDTCARRYFWDBALAMTINBLTCRCY Data Element: GLO_CR_CFWD_BAL_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CRDTCARRYFWDBALAMTINBLTCRCY
|
PSRTRLBALITM-PREVPERIODYTDAMTINBALTRANSCRCY table field - Previous Period YTD Amount in Company Code Currency
▼
Description: Previous Period YTD Amount in Company Code Currency Field Name: PREVPERIODYTDAMTINBALTRANSCRCY Data Element: GLO_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVPERIODYTDAMTINBALTRANSCRCY
|
PSRTRLBALITM-DEBITPREVPERDYTDAMTINBLTCRCY table field - Debit Previous Period YTD Amount in Balance Transaction Crcy
▼
Description: Debit Previous Period YTD Amount in Balance Transaction Crcy Field Name: DEBITPREVPERDYTDAMTINBLTCRCY Data Element: GLO_DR_YTD_BAL_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITPREVPERDYTDAMTINBLTCRCY
|
PSRTRLBALITM-CRDTPREVPERDYTDAMTINBLTCRCY table field - Credit Previous Period YTD Amount in Bal Transaction Crcy
▼
Description: Credit Previous Period YTD Amount in Bal Transaction Crcy Field Name: CRDTPREVPERDYTDAMTINBLTCRCY Data Element: GLO_CR_YTD_BAL_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CRDTPREVPERDYTDAMTINBLTCRCY
|
PSRTRLBALITM-STARTINGBALAMTINBALTRANSCRCY table field - Starting Balance in Company Code Currency
▼
Description: Starting Balance in Company Code Currency Field Name: STARTINGBALAMTINBALTRANSCRCY Data Element: FIS_START_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STARTINGBALAMTINBALTRANSCRCY
|
PSRTRLBALITM-DEBITSTRTGBALAMTINBALTRANSCRCY table field - Debit Starting Balance Amount in Balance Transaction Crcy
▼
Description: Debit Starting Balance Amount in Balance Transaction Crcy Field Name: DEBITSTRTGBALAMTINBALTRANSCRCY Data Element: GLO_DR_STRT_BAL_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITSTRTGBALAMTINBALTRANSCRCY
|
PSRTRLBALITM-CRDTSTRTGBALAMTINBALTRANSCRCY table field - Credit Starting Balance Amount in Balance Transaction Crcy
▼
Description: Credit Starting Balance Amount in Balance Transaction Crcy Field Name: CRDTSTRTGBALAMTINBALTRANSCRCY Data Element: GLO_CR_STRT_BAL_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CRDTSTRTGBALAMTINBALTRANSCRCY
|
PSRTRLBALITM-AMOUNTINBALANCETRANSACCRCY table field -
▼
Description: Field Name: AMOUNTINBALANCETRANSACCRCY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINBALANCETRANSACCRCY
|
PSRTRLBALITM-DEBITAMOUNTINBALANCETRANSCRCY table field - Debit Amount in Balance Transaction Currency
▼
Description: Debit Amount in Balance Transaction Currency Field Name: DEBITAMOUNTINBALANCETRANSCRCY Data Element: FIS_DR_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITAMOUNTINBALANCETRANSCRCY
|
PSRTRLBALITM-CREDITAMOUNTINBALANCETRANSCRCY table field - Credit Amount in Balance Transaction Currency
▼
Description: Credit Amount in Balance Transaction Currency Field Name: CREDITAMOUNTINBALANCETRANSCRCY Data Element: FIS_CR_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITAMOUNTINBALANCETRANSCRCY
|
PSRTRLBALITM-ENDINGBALANCEAMTINBALTRANSCRCY table field - Ending Balance in Company Code Currency
▼
Description: Ending Balance in Company Code Currency Field Name: ENDINGBALANCEAMTINBALTRANSCRCY Data Element: FIS_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENDINGBALANCEAMTINBALTRANSCRCY
|
PSRTRLBALITM-DEBITENDGBALAMTINBALTRANSCRCY table field - Debit Ending Balance Amount in Balance Transaction Currency
▼
Description: Debit Ending Balance Amount in Balance Transaction Currency Field Name: DEBITENDGBALAMTINBALTRANSCRCY Data Element: GLO_DR_END_BAL_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITENDGBALAMTINBALTRANSCRCY
|
PSRTRLBALITM-CREDITENDGBALAMTINBALTRANSCRCY table field - Credit Ending Balance Amount in Balance Transaction Currency
▼
Description: Credit Ending Balance Amount in Balance Transaction Currency Field Name: CREDITENDGBALAMTINBALTRANSCRCY Data Element: GLO_CR_END_BAL_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITENDGBALAMTINBALTRANSCRCY
|
PSRTRLBALITM-YEARTODATEAMOUNTINBALTRANSCRCY table field - Year to Date Amount in Company Code Currency
▼
Description: Year to Date Amount in Company Code Currency Field Name: YEARTODATEAMOUNTINBALTRANSCRCY Data Element: GLO_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YEARTODATEAMOUNTINBALTRANSCRCY
|
PSRTRLBALITM-DEBITYTDAMOUNTINBALTRANSCRCY table field - Debit Year to Date Amount in Balance Transaction Currency
▼
Description: Debit Year to Date Amount in Balance Transaction Currency Field Name: DEBITYTDAMOUNTINBALTRANSCRCY Data Element: GLO_DR_CYTD_BAL_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITYTDAMOUNTINBALTRANSCRCY
|
PSRTRLBALITM-CREDITYTDAMOUNTINBALTRANSCRCY table field - Credit Year to Date Amount in Balance Transaction Currency
▼
Description: Credit Year to Date Amount in Balance Transaction Currency Field Name: CREDITYTDAMOUNTINBALTRANSCRCY Data Element: GLO_CR_CYTD_BAL_TSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITYTDAMOUNTINBALTRANSCRCY
|
PSRTRLBALITM-GLOBALCURRENCY table field - Global Currency
▼
Description: Global Currency Field Name: GLOBALCURRENCY Data Element: FIS_RKCUR Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GLOBALCURRENCY
|
PSRTRLBALITM-CARRYFWDBALANCEAMTINGLOBALCRCY table field - Carry Forward Balance Amount in Global Currency
▼
Description: Carry Forward Balance Amount in Global Currency Field Name: CARRYFWDBALANCEAMTINGLOBALCRCY Data Element: GLO_CFWD_BAL_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CARRYFWDBALANCEAMTINGLOBALCRCY
|
PSRTRLBALITM-DEBITCARRYFWDBALAMTINGLOBCRCY table field - Debit Carry Forward Balance Amount in Global Currency
▼
Description: Debit Carry Forward Balance Amount in Global Currency Field Name: DEBITCARRYFWDBALAMTINGLOBCRCY Data Element: GLO_DR_CFWD_BAL_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCARRYFWDBALAMTINGLOBCRCY
|
PSRTRLBALITM-CRDTCARRYFWDBALAMTINGLOBALCRCY table field - Credit Carry Forward Balance Amount in Global Currency
▼
Description: Credit Carry Forward Balance Amount in Global Currency Field Name: CRDTCARRYFWDBALAMTINGLOBALCRCY Data Element: GLO_CR_CFWD_BAL_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CRDTCARRYFWDBALAMTINGLOBALCRCY
|
PSRTRLBALITM-PREVPERDYTDAMOUNTINGLOBALCRCY table field - Previous Period YTD Amount in Company Code Currency
▼
Description: Previous Period YTD Amount in Company Code Currency Field Name: PREVPERDYTDAMOUNTINGLOBALCRCY Data Element: GLO_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVPERDYTDAMOUNTINGLOBALCRCY
|
PSRTRLBALITM-DEBITPREVPERDYTDAMTINGLOBCRCY table field - Debit Previous Period YTD Amount in Global Currency
▼
Description: Debit Previous Period YTD Amount in Global Currency Field Name: DEBITPREVPERDYTDAMTINGLOBCRCY Data Element: GLO_DR_YTD_BAL_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITPREVPERDYTDAMTINGLOBCRCY
|
PSRTRLBALITM-CREDITPREVPERDYTDAMTINGLOBCRCY table field - Credit Previous Period YTD Amount in Global Currency
▼
Description: Credit Previous Period YTD Amount in Global Currency Field Name: CREDITPREVPERDYTDAMTINGLOBCRCY Data Element: GLO_CR_YTD_BAL_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITPREVPERDYTDAMTINGLOBCRCY
|
PSRTRLBALITM-STARTINGBALANCEAMTINGLOBALCRCY table field - Starting Balance in Company Code Currency
▼
Description: Starting Balance in Company Code Currency Field Name: STARTINGBALANCEAMTINGLOBALCRCY Data Element: FIS_START_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STARTINGBALANCEAMTINGLOBALCRCY
|
PSRTRLBALITM-DEBITSTARTINGBALAMTINGLOBCRCY table field - Debit Starting Balance Amount in Global Currency
▼
Description: Debit Starting Balance Amount in Global Currency Field Name: DEBITSTARTINGBALAMTINGLOBCRCY Data Element: GLO_DR_STRT_BAL_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITSTARTINGBALAMTINGLOBCRCY
|
PSRTRLBALITM-CREDITSTARTINGBALAMTINGLOBCRCY table field - Credit Starting Balance Amount in Global Currency
▼
Description: Credit Starting Balance Amount in Global Currency Field Name: CREDITSTARTINGBALAMTINGLOBCRCY Data Element: GLO_CR_STRT_BAL_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITSTARTINGBALAMTINGLOBCRCY
|
PSRTRLBALITM-AMOUNTINGLOBALCURRENCY table field -
▼
Description: Field Name: AMOUNTINGLOBALCURRENCY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINGLOBALCURRENCY
|
PSRTRLBALITM-DEBITAMOUNTINGLOBALCRCY table field - Debit Amount in Global Currency
▼
Description: Debit Amount in Global Currency Field Name: DEBITAMOUNTINGLOBALCRCY Data Element: FIS_DR_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITAMOUNTINGLOBALCRCY
|
PSRTRLBALITM-CREDITAMOUNTINGLOBALCRCY table field - Credit Amount in Global Currency
▼
Description: Credit Amount in Global Currency Field Name: CREDITAMOUNTINGLOBALCRCY Data Element: FIS_CR_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITAMOUNTINGLOBALCRCY
|
PSRTRLBALITM-ENDINGBALANCEAMTINGLOBALCRCY table field - Ending Balance in Company Code Currency
▼
Description: Ending Balance in Company Code Currency Field Name: ENDINGBALANCEAMTINGLOBALCRCY Data Element: FIS_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENDINGBALANCEAMTINGLOBALCRCY
|
PSRTRLBALITM-DEBITENDINGBALAMTINGLOBALCRCY table field - Debit Ending Balance Amount in Global Currency
▼
Description: Debit Ending Balance Amount in Global Currency Field Name: DEBITENDINGBALAMTINGLOBALCRCY Data Element: GLO_DR_END_BAL_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITENDINGBALAMTINGLOBALCRCY
|
PSRTRLBALITM-CREDITENDINGBALAMTINGLOBALCRCY table field - Credit Ending Balance Amount in Global Currency
▼
Description: Credit Ending Balance Amount in Global Currency Field Name: CREDITENDINGBALAMTINGLOBALCRCY Data Element: GLO_CR_END_BAL_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITENDINGBALAMTINGLOBALCRCY
|
PSRTRLBALITM-YEARTODATEAMOUNTINGLOBALCRCY table field - Year to Date Amount in Company Code Currency
▼
Description: Year to Date Amount in Company Code Currency Field Name: YEARTODATEAMOUNTINGLOBALCRCY Data Element: GLO_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YEARTODATEAMOUNTINGLOBALCRCY
|
PSRTRLBALITM-DEBITYTDAMOUNTINGLOBALCURRENCY table field - Debit Year to Date Amount in Global Currency
▼
Description: Debit Year to Date Amount in Global Currency Field Name: DEBITYTDAMOUNTINGLOBALCURRENCY Data Element: GLO_DR_CYTD_BAL_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITYTDAMOUNTINGLOBALCURRENCY
|
PSRTRLBALITM-CREDITYTDAMTINGLOBALCURRENCY table field - Credit Year to Date Amount in Global Currency
▼
Description: Credit Year to Date Amount in Global Currency Field Name: CREDITYTDAMTINGLOBALCURRENCY Data Element: GLO_CR_CYTD_BAL_KSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITYTDAMTINGLOBALCURRENCY
|
PSRTRLBALITM-FREEDEFINEDCURRENCY1 table field - Freely Defined Currency 1
▼
Description: Freely Defined Currency 1 Field Name: FREEDEFINEDCURRENCY1 Data Element: FIS_ROCUR Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FREEDEFINEDCURRENCY1
|
PSRTRLBALITM-CARRYFWDBALAMOUNTINFDCRCY1 table field - Carry Forward Balance Amount in Freely Defined Crcy 1
▼
Description: Carry Forward Balance Amount in Freely Defined Crcy 1 Field Name: CARRYFWDBALAMOUNTINFDCRCY1 Data Element: GLO_CFWD_BAL_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CARRYFWDBALAMOUNTINFDCRCY1
|
PSRTRLBALITM-DEBITCARRYFWDBALAMTINFDCRCY1 table field - Debit Carry Forward Balance Amount in Freely Defined Crcy 1
▼
Description: Debit Carry Forward Balance Amount in Freely Defined Crcy 1 Field Name: DEBITCARRYFWDBALAMTINFDCRCY1 Data Element: GLO_DR_CFWD_BAL_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCARRYFWDBALAMTINFDCRCY1
|
PSRTRLBALITM-CREDITCARRYFWDBALAMTINFDCRCY1 table field - Credit Carry Forward Balance Amount in Freely Defined Crcy 1
▼
Description: Credit Carry Forward Balance Amount in Freely Defined Crcy 1 Field Name: CREDITCARRYFWDBALAMTINFDCRCY1 Data Element: GLO_CR_CFWD_BAL_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITCARRYFWDBALAMTINFDCRCY1
|
PSRTRLBALITM-PREVPERDYTDAMOUNTINFDCRCY1 table field - Previous Period YTD Amount in Company Code Currency
▼
Description: Previous Period YTD Amount in Company Code Currency Field Name: PREVPERDYTDAMOUNTINFDCRCY1 Data Element: GLO_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVPERDYTDAMOUNTINFDCRCY1
|
PSRTRLBALITM-DEBITPREVPERDYTDAMTINFDCRCY1 table field - Debit Previous Period YTD Amount in Freely Defined Crcy 1
▼
Description: Debit Previous Period YTD Amount in Freely Defined Crcy 1 Field Name: DEBITPREVPERDYTDAMTINFDCRCY1 Data Element: GLO_DR_YTD_BAL_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITPREVPERDYTDAMTINFDCRCY1
|
PSRTRLBALITM-CREDITPREVPERDYTDAMTINFDCRCY1 table field - Credit Previous Period YTD Amount in Freely Defined Crcy 1
▼
Description: Credit Previous Period YTD Amount in Freely Defined Crcy 1 Field Name: CREDITPREVPERDYTDAMTINFDCRCY1 Data Element: GLO_CR_YTD_BAL_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITPREVPERDYTDAMTINFDCRCY1
|
PSRTRLBALITM-STRTGBALAMTINFREEDFNDCRCY1 table field - Starting Balance in Company Code Currency
▼
Description: Starting Balance in Company Code Currency Field Name: STRTGBALAMTINFREEDFNDCRCY1 Data Element: FIS_START_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STRTGBALAMTINFREEDFNDCRCY1
|
PSRTRLBALITM-DEBITSTARTBALAMOUNTINFDCRCY1 table field - Debit Starting Balance Amount in Freely Defined Currency 1
▼
Description: Debit Starting Balance Amount in Freely Defined Currency 1 Field Name: DEBITSTARTBALAMOUNTINFDCRCY1 Data Element: GLO_DR_STRT_BAL_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITSTARTBALAMOUNTINFDCRCY1
|
PSRTRLBALITM-CREDITSTARTBALAMOUNTINFDCRCY1 table field - Credit Starting Balance Amount in Freely Defined Currency 1
▼
Description: Credit Starting Balance Amount in Freely Defined Currency 1 Field Name: CREDITSTARTBALAMOUNTINFDCRCY1 Data Element: GLO_CR_STRT_BAL_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITSTARTBALAMOUNTINFDCRCY1
|
PSRTRLBALITM-AMOUNTINFREEDEFINEDCURRENCY1 table field -
▼
Description: Field Name: AMOUNTINFREEDEFINEDCURRENCY1 Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINFREEDEFINEDCURRENCY1
|
PSRTRLBALITM-DEBITAMOUNTINFREEDFNDCRCY1 table field - Debit Amount in Free Defined Currency 1
▼
Description: Debit Amount in Free Defined Currency 1 Field Name: DEBITAMOUNTINFREEDFNDCRCY1 Data Element: FIS_DR_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITAMOUNTINFREEDFNDCRCY1
|
PSRTRLBALITM-CREDITAMOUNTINFREEDFNDCRCY1 table field - Credit Amount in Free Defined Currency 1
▼
Description: Credit Amount in Free Defined Currency 1 Field Name: CREDITAMOUNTINFREEDFNDCRCY1 Data Element: FIS_CR_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITAMOUNTINFREEDFNDCRCY1
|
PSRTRLBALITM-ENDINGBALAMTINFREEDFNDCRCY1 table field - Ending Balance in Company Code Currency
▼
Description: Ending Balance in Company Code Currency Field Name: ENDINGBALAMTINFREEDFNDCRCY1 Data Element: FIS_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENDINGBALAMTINFREEDFNDCRCY1
|
PSRTRLBALITM-DEBITENDINGBALAMOUNTINFDCRCY1 table field - Debit Ending Balance Amount in Freely Defined Currency 1
▼
Description: Debit Ending Balance Amount in Freely Defined Currency 1 Field Name: DEBITENDINGBALAMOUNTINFDCRCY1 Data Element: GLO_DR_END_BAL_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITENDINGBALAMOUNTINFDCRCY1
|
PSRTRLBALITM-CREDITENDINGBALAMOUNTINFDCRCY1 table field - Credit Ending Balance Amount in Freely Defined Currency 1
▼
Description: Credit Ending Balance Amount in Freely Defined Currency 1 Field Name: CREDITENDINGBALAMOUNTINFDCRCY1 Data Element: GLO_CR_END_BAL_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITENDINGBALAMOUNTINFDCRCY1
|
PSRTRLBALITM-YEARTODATEAMOUNTINFDCRCY1 table field - Year to Date Amount in Company Code Currency
▼
Description: Year to Date Amount in Company Code Currency Field Name: YEARTODATEAMOUNTINFDCRCY1 Data Element: GLO_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YEARTODATEAMOUNTINFDCRCY1
|
PSRTRLBALITM-DEBITYTDAMOUNTINFDCRCY1 table field - Debit Year to Date Amount in Freely Defined Currency 1
▼
Description: Debit Year to Date Amount in Freely Defined Currency 1 Field Name: DEBITYTDAMOUNTINFDCRCY1 Data Element: GLO_DR_CYTD_BAL_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITYTDAMOUNTINFDCRCY1
|
PSRTRLBALITM-CREDITYTDAMOUNTINFDCRCY1 table field - Credit Year to Date Amount in Freely Defined Currency 1
▼
Description: Credit Year to Date Amount in Freely Defined Currency 1 Field Name: CREDITYTDAMOUNTINFDCRCY1 Data Element: GLO_CR_CYTD_BAL_OSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITYTDAMOUNTINFDCRCY1
|
PSRTRLBALITM-FREEDEFINEDCURRENCY2 table field - Freely Defined Currency 2
▼
Description: Freely Defined Currency 2 Field Name: FREEDEFINEDCURRENCY2 Data Element: FIS_RVCUR Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FREEDEFINEDCURRENCY2
|
PSRTRLBALITM-CARRYFWDBALAMOUNTINFDCRCY2 table field - Carry Forward Balance Amount in Freely Defined Crcy 2
▼
Description: Carry Forward Balance Amount in Freely Defined Crcy 2 Field Name: CARRYFWDBALAMOUNTINFDCRCY2 Data Element: GLO_CFWD_BAL_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CARRYFWDBALAMOUNTINFDCRCY2
|
PSRTRLBALITM-DEBITCARRYFWDBALAMTINFDCRCY2 table field - Debit Carry Forward Balance Amount in Freely Defined Crcy 2
▼
Description: Debit Carry Forward Balance Amount in Freely Defined Crcy 2 Field Name: DEBITCARRYFWDBALAMTINFDCRCY2 Data Element: GLO_DR_CFWD_BAL_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCARRYFWDBALAMTINFDCRCY2
|
PSRTRLBALITM-CREDITCARRYFWDBALAMTINFDCRCY2 table field - Credit Carry Forward Balance Amount in Freely Defined Crcy 2
▼
Description: Credit Carry Forward Balance Amount in Freely Defined Crcy 2 Field Name: CREDITCARRYFWDBALAMTINFDCRCY2 Data Element: GLO_CR_CFWD_BAL_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITCARRYFWDBALAMTINFDCRCY2
|
PSRTRLBALITM-PREVPERDYTDAMOUNTINFDCRCY2 table field - Previous Period YTD Amount in Company Code Currency
▼
Description: Previous Period YTD Amount in Company Code Currency Field Name: PREVPERDYTDAMOUNTINFDCRCY2 Data Element: GLO_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVPERDYTDAMOUNTINFDCRCY2
|
PSRTRLBALITM-DEBITPREVPERDYTDAMTINFDCRCY2 table field - Debit Previous Period YTD Amount in Freely Defined Crcy 2
▼
Description: Debit Previous Period YTD Amount in Freely Defined Crcy 2 Field Name: DEBITPREVPERDYTDAMTINFDCRCY2 Data Element: GLO_DR_YTD_BAL_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITPREVPERDYTDAMTINFDCRCY2
|
PSRTRLBALITM-CREDITPREVPERDYTDAMTINFDCRCY2 table field - Credit Previous Period YTD Amount in Freely Defined Crcy 2
▼
Description: Credit Previous Period YTD Amount in Freely Defined Crcy 2 Field Name: CREDITPREVPERDYTDAMTINFDCRCY2 Data Element: GLO_CR_YTD_BAL_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITPREVPERDYTDAMTINFDCRCY2
|
PSRTRLBALITM-STRTGBALAMTINFREEDFNDCRCY2 table field - Starting Balance in Company Code Currency
▼
Description: Starting Balance in Company Code Currency Field Name: STRTGBALAMTINFREEDFNDCRCY2 Data Element: FIS_START_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STRTGBALAMTINFREEDFNDCRCY2
|
PSRTRLBALITM-DEBITSTARTBALAMOUNTINFDCRCY2 table field - Debit Starting Balance Amount in Freely Defined Currency 2
▼
Description: Debit Starting Balance Amount in Freely Defined Currency 2 Field Name: DEBITSTARTBALAMOUNTINFDCRCY2 Data Element: GLO_DR_STRT_BAL_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITSTARTBALAMOUNTINFDCRCY2
|
PSRTRLBALITM-CREDITSTARTBALAMOUNTINFDCRCY2 table field - Credit Starting Balance Amount in Freely Defined Currency 2
▼
Description: Credit Starting Balance Amount in Freely Defined Currency 2 Field Name: CREDITSTARTBALAMOUNTINFDCRCY2 Data Element: GLO_CR_STRT_BAL_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITSTARTBALAMOUNTINFDCRCY2
|
PSRTRLBALITM-AMOUNTINFREEDEFINEDCURRENCY2 table field -
▼
Description: Field Name: AMOUNTINFREEDEFINEDCURRENCY2 Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINFREEDEFINEDCURRENCY2
|
PSRTRLBALITM-DEBITAMOUNTINFREEDFNDCRCY2 table field - Debit Amount in Free Defined Currency 2
▼
Description: Debit Amount in Free Defined Currency 2 Field Name: DEBITAMOUNTINFREEDFNDCRCY2 Data Element: FIS_DR_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITAMOUNTINFREEDFNDCRCY2
|
PSRTRLBALITM-CREDITAMOUNTINFREEDFNDCRCY2 table field - Credit Amount in Free Defined Currency 2
▼
Description: Credit Amount in Free Defined Currency 2 Field Name: CREDITAMOUNTINFREEDFNDCRCY2 Data Element: FIS_CR_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITAMOUNTINFREEDFNDCRCY2
|
PSRTRLBALITM-ENDINGBALAMTINFREEDFNDCRCY2 table field - Ending Balance in Company Code Currency
▼
Description: Ending Balance in Company Code Currency Field Name: ENDINGBALAMTINFREEDFNDCRCY2 Data Element: FIS_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENDINGBALAMTINFREEDFNDCRCY2
|
PSRTRLBALITM-DEBITENDINGBALAMOUNTINFDCRCY2 table field - Debit Ending Balance Amount in Freely Defined Currency 2
▼
Description: Debit Ending Balance Amount in Freely Defined Currency 2 Field Name: DEBITENDINGBALAMOUNTINFDCRCY2 Data Element: GLO_DR_END_BAL_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITENDINGBALAMOUNTINFDCRCY2
|
PSRTRLBALITM-CREDITENDINGBALAMOUNTINFDCRCY2 table field - Credit Ending Balance Amount in Freely Defined Currency 2
▼
Description: Credit Ending Balance Amount in Freely Defined Currency 2 Field Name: CREDITENDINGBALAMOUNTINFDCRCY2 Data Element: GLO_CR_END_BAL_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITENDINGBALAMOUNTINFDCRCY2
|
PSRTRLBALITM-YEARTODATEAMOUNTINFDCRCY2 table field - Year to Date Amount in Company Code Currency
▼
Description: Year to Date Amount in Company Code Currency Field Name: YEARTODATEAMOUNTINFDCRCY2 Data Element: GLO_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YEARTODATEAMOUNTINFDCRCY2
|
PSRTRLBALITM-DEBITYTDAMOUNTINFDCRCY2 table field - Debit Year to Date Amount in Freely Defined Currency 2
▼
Description: Debit Year to Date Amount in Freely Defined Currency 2 Field Name: DEBITYTDAMOUNTINFDCRCY2 Data Element: GLO_DR_CYTD_BAL_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITYTDAMOUNTINFDCRCY2
|
PSRTRLBALITM-CREDITYTDAMOUNTINFDCRCY2 table field - Credit Year to Date Amount in Freely Defined Currency 2
▼
Description: Credit Year to Date Amount in Freely Defined Currency 2 Field Name: CREDITYTDAMOUNTINFDCRCY2 Data Element: GLO_CR_CYTD_BAL_VSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITYTDAMOUNTINFDCRCY2
|
PSRTRLBALITM-FREEDEFINEDCURRENCY3 table field - Freely Defined Currency 3
▼
Description: Freely Defined Currency 3 Field Name: FREEDEFINEDCURRENCY3 Data Element: FIS_CURR3 Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FREEDEFINEDCURRENCY3
|
PSRTRLBALITM-CARRYFWDBALAMOUNTINFDCRCY3 table field - Carry Forward Balance Amount in Freely Defined Crcy 3
▼
Description: Carry Forward Balance Amount in Freely Defined Crcy 3 Field Name: CARRYFWDBALAMOUNTINFDCRCY3 Data Element: GLO_CFWD_BAL_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CARRYFWDBALAMOUNTINFDCRCY3
|
PSRTRLBALITM-DEBITCARRYFWDBALAMTINFDCRCY3 table field - Debit Carry Forward Balance Amount in Freely Defined Crcy 3
▼
Description: Debit Carry Forward Balance Amount in Freely Defined Crcy 3 Field Name: DEBITCARRYFWDBALAMTINFDCRCY3 Data Element: GLO_DR_CFWD_BAL_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCARRYFWDBALAMTINFDCRCY3
|
PSRTRLBALITM-CREDITCARRYFWDBALAMTINFDCRCY3 table field - Credit Carry Forward Balance Amount in Freely Defined Crcy 3
▼
Description: Credit Carry Forward Balance Amount in Freely Defined Crcy 3 Field Name: CREDITCARRYFWDBALAMTINFDCRCY3 Data Element: GLO_CR_CFWD_BAL_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITCARRYFWDBALAMTINFDCRCY3
|
PSRTRLBALITM-PREVPERDYTDAMOUNTINFDCRCY3 table field - Previous Period YTD Amount in Company Code Currency
▼
Description: Previous Period YTD Amount in Company Code Currency Field Name: PREVPERDYTDAMOUNTINFDCRCY3 Data Element: GLO_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVPERDYTDAMOUNTINFDCRCY3
|
PSRTRLBALITM-DEBITPREVPERDYTDAMTINFDCRCY3 table field - Debit Previous Period YTD Amount in Freely Defined Crcy 3
▼
Description: Debit Previous Period YTD Amount in Freely Defined Crcy 3 Field Name: DEBITPREVPERDYTDAMTINFDCRCY3 Data Element: GLO_DR_YTD_BAL_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITPREVPERDYTDAMTINFDCRCY3
|
PSRTRLBALITM-CREDITPREVPERDYTDAMTINFDCRCY3 table field - Credit Previous Period YTD Amount in Freely Defined Crcy 3
▼
Description: Credit Previous Period YTD Amount in Freely Defined Crcy 3 Field Name: CREDITPREVPERDYTDAMTINFDCRCY3 Data Element: GLO_CR_YTD_BAL_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITPREVPERDYTDAMTINFDCRCY3
|
PSRTRLBALITM-STRTGBALAMTINFREEDFNDCRCY3 table field - Starting Balance in Company Code Currency
▼
Description: Starting Balance in Company Code Currency Field Name: STRTGBALAMTINFREEDFNDCRCY3 Data Element: FIS_START_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STRTGBALAMTINFREEDFNDCRCY3
|
PSRTRLBALITM-DEBITSTARTBALAMOUNTINFDCRCY3 table field - Debit Starting Balance Amount in Freely Defined Currency 3
▼
Description: Debit Starting Balance Amount in Freely Defined Currency 3 Field Name: DEBITSTARTBALAMOUNTINFDCRCY3 Data Element: GLO_DR_STRT_BAL_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITSTARTBALAMOUNTINFDCRCY3
|
PSRTRLBALITM-CREDITSTARTBALAMOUNTINFDCRCY3 table field - Credit Starting Balance Amount in Freely Defined Currency 3
▼
Description: Credit Starting Balance Amount in Freely Defined Currency 3 Field Name: CREDITSTARTBALAMOUNTINFDCRCY3 Data Element: GLO_CR_STRT_BAL_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITSTARTBALAMOUNTINFDCRCY3
|
PSRTRLBALITM-AMOUNTINFREEDEFINEDCURRENCY3 table field -
▼
Description: Field Name: AMOUNTINFREEDEFINEDCURRENCY3 Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINFREEDEFINEDCURRENCY3
|
PSRTRLBALITM-DEBITAMOUNTINFREEDFNDCRCY3 table field - Debit Amount in Free Defined Currency 3
▼
Description: Debit Amount in Free Defined Currency 3 Field Name: DEBITAMOUNTINFREEDFNDCRCY3 Data Element: FIS_DR_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITAMOUNTINFREEDFNDCRCY3
|
PSRTRLBALITM-CREDITAMOUNTINFREEDFNDCRCY3 table field - Credit Amount in Free Defined Currency 3
▼
Description: Credit Amount in Free Defined Currency 3 Field Name: CREDITAMOUNTINFREEDFNDCRCY3 Data Element: FIS_CR_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITAMOUNTINFREEDFNDCRCY3
|
PSRTRLBALITM-ENDINGBALAMTINFREEDFNDCRCY3 table field - Ending Balance in Company Code Currency
▼
Description: Ending Balance in Company Code Currency Field Name: ENDINGBALAMTINFREEDFNDCRCY3 Data Element: FIS_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENDINGBALAMTINFREEDFNDCRCY3
|
PSRTRLBALITM-DEBITENDINGBALAMOUNTINFDCRCY3 table field - Debit Ending Balance Amount in Freely Defined Currency 3
▼
Description: Debit Ending Balance Amount in Freely Defined Currency 3 Field Name: DEBITENDINGBALAMOUNTINFDCRCY3 Data Element: GLO_DR_END_BAL_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITENDINGBALAMOUNTINFDCRCY3
|
PSRTRLBALITM-CREDITENDINGBALAMOUNTINFDCRCY3 table field - Credit Ending Balance Amount in Freely Defined Currency 3
▼
Description: Credit Ending Balance Amount in Freely Defined Currency 3 Field Name: CREDITENDINGBALAMOUNTINFDCRCY3 Data Element: GLO_CR_END_BAL_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITENDINGBALAMOUNTINFDCRCY3
|
PSRTRLBALITM-YEARTODATEAMOUNTINFDCRCY3 table field - Year to Date Amount in Company Code Currency
▼
Description: Year to Date Amount in Company Code Currency Field Name: YEARTODATEAMOUNTINFDCRCY3 Data Element: GLO_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YEARTODATEAMOUNTINFDCRCY3
|
PSRTRLBALITM-DEBITYTDAMOUNTINFDCRCY3 table field - Debit Year to Date Amount in Freely Defined Currency 3
▼
Description: Debit Year to Date Amount in Freely Defined Currency 3 Field Name: DEBITYTDAMOUNTINFDCRCY3 Data Element: GLO_DR_CYTD_BAL_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITYTDAMOUNTINFDCRCY3
|
PSRTRLBALITM-CREDITYTDAMOUNTINFDCRCY3 table field - Credit Year to Date Amount in Freely Defined Currency 3
▼
Description: Credit Year to Date Amount in Freely Defined Currency 3 Field Name: CREDITYTDAMOUNTINFDCRCY3 Data Element: GLO_CR_CYTD_BAL_BSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITYTDAMOUNTINFDCRCY3
|
PSRTRLBALITM-FREEDEFINEDCURRENCY4 table field - Freely Defined Currency 4
▼
Description: Freely Defined Currency 4 Field Name: FREEDEFINEDCURRENCY4 Data Element: FIS_CURR4 Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FREEDEFINEDCURRENCY4
|
PSRTRLBALITM-CARRYFWDBALAMOUNTINFDCRCY4 table field - Carry Forward Balance Amount in Freely Defined Crcy 4
▼
Description: Carry Forward Balance Amount in Freely Defined Crcy 4 Field Name: CARRYFWDBALAMOUNTINFDCRCY4 Data Element: GLO_CFWD_BAL_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CARRYFWDBALAMOUNTINFDCRCY4
|
PSRTRLBALITM-DEBITCARRYFWDBALAMTINFDCRCY4 table field - Debit Carry Forward Balance Amount in Freely Defined Crcy 4
▼
Description: Debit Carry Forward Balance Amount in Freely Defined Crcy 4 Field Name: DEBITCARRYFWDBALAMTINFDCRCY4 Data Element: GLO_DR_CFWD_BAL_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCARRYFWDBALAMTINFDCRCY4
|
PSRTRLBALITM-CREDITCARRYFWDBALAMTINFDCRCY4 table field - Credit Carry Forward Balance Amount in Freely Defined Crcy 4
▼
Description: Credit Carry Forward Balance Amount in Freely Defined Crcy 4 Field Name: CREDITCARRYFWDBALAMTINFDCRCY4 Data Element: GLO_CR_CFWD_BAL_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITCARRYFWDBALAMTINFDCRCY4
|
PSRTRLBALITM-PREVPERDYTDAMOUNTINFDCRCY4 table field - Previous Period YTD Amount in Company Code Currency
▼
Description: Previous Period YTD Amount in Company Code Currency Field Name: PREVPERDYTDAMOUNTINFDCRCY4 Data Element: GLO_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVPERDYTDAMOUNTINFDCRCY4
|
PSRTRLBALITM-DEBITPREVPERDYTDAMTINFDCRCY4 table field - Debit Previous Period YTD Amount in Freely Defined Crcy 4
▼
Description: Debit Previous Period YTD Amount in Freely Defined Crcy 4 Field Name: DEBITPREVPERDYTDAMTINFDCRCY4 Data Element: GLO_DR_YTD_BAL_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITPREVPERDYTDAMTINFDCRCY4
|
PSRTRLBALITM-CREDITPREVPERDYTDAMTINFDCRCY4 table field - Credit Previous Period YTD Amount in Freely Defined Crcy 4
▼
Description: Credit Previous Period YTD Amount in Freely Defined Crcy 4 Field Name: CREDITPREVPERDYTDAMTINFDCRCY4 Data Element: GLO_CR_YTD_BAL_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITPREVPERDYTDAMTINFDCRCY4
|
PSRTRLBALITM-STRTGBALAMTINFREEDFNDCRCY4 table field - Starting Balance in Company Code Currency
▼
Description: Starting Balance in Company Code Currency Field Name: STRTGBALAMTINFREEDFNDCRCY4 Data Element: FIS_START_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STRTGBALAMTINFREEDFNDCRCY4
|
PSRTRLBALITM-DEBITSTARTBALAMOUNTINFDCRCY4 table field - Debit Starting Balance Amount in Freely Defined Currency 4
▼
Description: Debit Starting Balance Amount in Freely Defined Currency 4 Field Name: DEBITSTARTBALAMOUNTINFDCRCY4 Data Element: GLO_DR_STRT_BAL_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITSTARTBALAMOUNTINFDCRCY4
|
PSRTRLBALITM-CREDITSTARTBALAMOUNTINFDCRCY4 table field - Credit Starting Balance Amount in Freely Defined Currency 4
▼
Description: Credit Starting Balance Amount in Freely Defined Currency 4 Field Name: CREDITSTARTBALAMOUNTINFDCRCY4 Data Element: GLO_CR_STRT_BAL_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITSTARTBALAMOUNTINFDCRCY4
|
PSRTRLBALITM-AMOUNTINFREEDEFINEDCURRENCY4 table field -
▼
Description: Field Name: AMOUNTINFREEDEFINEDCURRENCY4 Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINFREEDEFINEDCURRENCY4
|
PSRTRLBALITM-DEBITAMOUNTINFREEDFNDCRCY4 table field - Debit Amount in Free Defined Currency 4
▼
Description: Debit Amount in Free Defined Currency 4 Field Name: DEBITAMOUNTINFREEDFNDCRCY4 Data Element: FIS_DR_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITAMOUNTINFREEDFNDCRCY4
|
PSRTRLBALITM-CREDITAMOUNTINFREEDFNDCRCY4 table field - Credit Amount in Free Defined Currency 4
▼
Description: Credit Amount in Free Defined Currency 4 Field Name: CREDITAMOUNTINFREEDFNDCRCY4 Data Element: FIS_CR_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITAMOUNTINFREEDFNDCRCY4
|
PSRTRLBALITM-ENDINGBALAMTINFREEDFNDCRCY4 table field - Ending Balance in Company Code Currency
▼
Description: Ending Balance in Company Code Currency Field Name: ENDINGBALAMTINFREEDFNDCRCY4 Data Element: FIS_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENDINGBALAMTINFREEDFNDCRCY4
|
PSRTRLBALITM-DEBITENDINGBALAMOUNTINFDCRCY4 table field - Debit Ending Balance Amount in Freely Defined Currency 4
▼
Description: Debit Ending Balance Amount in Freely Defined Currency 4 Field Name: DEBITENDINGBALAMOUNTINFDCRCY4 Data Element: GLO_DR_END_BAL_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITENDINGBALAMOUNTINFDCRCY4
|
PSRTRLBALITM-CREDITENDINGBALAMOUNTINFDCRCY4 table field - Credit Ending Balance Amount in Freely Defined Currency 4
▼
Description: Credit Ending Balance Amount in Freely Defined Currency 4 Field Name: CREDITENDINGBALAMOUNTINFDCRCY4 Data Element: GLO_CR_END_BAL_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITENDINGBALAMOUNTINFDCRCY4
|
PSRTRLBALITM-YEARTODATEAMOUNTINFDCRCY4 table field - Year to Date Amount in Company Code Currency
▼
Description: Year to Date Amount in Company Code Currency Field Name: YEARTODATEAMOUNTINFDCRCY4 Data Element: GLO_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YEARTODATEAMOUNTINFDCRCY4
|
PSRTRLBALITM-DEBITYTDAMOUNTINFDCRCY4 table field - Debit Year to Date Amount in Freely Defined Currency 4
▼
Description: Debit Year to Date Amount in Freely Defined Currency 4 Field Name: DEBITYTDAMOUNTINFDCRCY4 Data Element: GLO_DR_CYTD_BAL_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITYTDAMOUNTINFDCRCY4
|
PSRTRLBALITM-CREDITYTDAMOUNTINFDCRCY4 table field - Credit Year to Date Amount in Freely Defined Currency 4
▼
Description: Credit Year to Date Amount in Freely Defined Currency 4 Field Name: CREDITYTDAMOUNTINFDCRCY4 Data Element: GLO_CR_CYTD_BAL_CSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITYTDAMOUNTINFDCRCY4
|
PSRTRLBALITM-FREEDEFINEDCURRENCY5 table field - Freely Defined Currency 5
▼
Description: Freely Defined Currency 5 Field Name: FREEDEFINEDCURRENCY5 Data Element: FIS_CURR5 Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FREEDEFINEDCURRENCY5
|
PSRTRLBALITM-CARRYFWDBALAMOUNTINFDCRCY5 table field - Carry Forward Balance Amount in Freely Defined Crcy 5
▼
Description: Carry Forward Balance Amount in Freely Defined Crcy 5 Field Name: CARRYFWDBALAMOUNTINFDCRCY5 Data Element: GLO_CFWD_BAL_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CARRYFWDBALAMOUNTINFDCRCY5
|
PSRTRLBALITM-DEBITCARRYFWDBALAMTINFDCRCY5 table field - Debit Carry Forward Balance Amount in Freely Defined Crcy 5
▼
Description: Debit Carry Forward Balance Amount in Freely Defined Crcy 5 Field Name: DEBITCARRYFWDBALAMTINFDCRCY5 Data Element: GLO_DR_CFWD_BAL_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCARRYFWDBALAMTINFDCRCY5
|
PSRTRLBALITM-CREDITCARRYFWDBALAMTINFDCRCY5 table field - Credit Carry Forward Balance Amount in Freely Defined Crcy 5
▼
Description: Credit Carry Forward Balance Amount in Freely Defined Crcy 5 Field Name: CREDITCARRYFWDBALAMTINFDCRCY5 Data Element: GLO_CR_CFWD_BAL_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITCARRYFWDBALAMTINFDCRCY5
|
PSRTRLBALITM-PREVPERDYTDAMOUNTINFDCRCY5 table field - Previous Period YTD Amount in Company Code Currency
▼
Description: Previous Period YTD Amount in Company Code Currency Field Name: PREVPERDYTDAMOUNTINFDCRCY5 Data Element: GLO_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVPERDYTDAMOUNTINFDCRCY5
|
PSRTRLBALITM-DEBITPREVPERDYTDAMTINFDCRCY5 table field - Debit Previous Period YTD Amount in Freely Defined Crcy 5
▼
Description: Debit Previous Period YTD Amount in Freely Defined Crcy 5 Field Name: DEBITPREVPERDYTDAMTINFDCRCY5 Data Element: GLO_DR_YTD_BAL_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITPREVPERDYTDAMTINFDCRCY5
|
PSRTRLBALITM-CREDITPREVPERDYTDAMTINFDCRCY5 table field - Credit Previous Period YTD Amount in Freely Defined Crcy 5
▼
Description: Credit Previous Period YTD Amount in Freely Defined Crcy 5 Field Name: CREDITPREVPERDYTDAMTINFDCRCY5 Data Element: GLO_CR_YTD_BAL_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITPREVPERDYTDAMTINFDCRCY5
|
PSRTRLBALITM-STRTGBALAMTINFREEDFNDCRCY5 table field - Starting Balance in Company Code Currency
▼
Description: Starting Balance in Company Code Currency Field Name: STRTGBALAMTINFREEDFNDCRCY5 Data Element: FIS_START_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STRTGBALAMTINFREEDFNDCRCY5
|
PSRTRLBALITM-DEBITSTARTBALAMOUNTINFDCRCY5 table field - Debit Starting Balance Amount in Freely Defined Currency 5
▼
Description: Debit Starting Balance Amount in Freely Defined Currency 5 Field Name: DEBITSTARTBALAMOUNTINFDCRCY5 Data Element: GLO_DR_STRT_BAL_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITSTARTBALAMOUNTINFDCRCY5
|
PSRTRLBALITM-CREDITSTARTBALAMOUNTINFDCRCY5 table field - Credit Starting Balance Amount in Freely Defined Currency 5
▼
Description: Credit Starting Balance Amount in Freely Defined Currency 5 Field Name: CREDITSTARTBALAMOUNTINFDCRCY5 Data Element: GLO_CR_STRT_BAL_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITSTARTBALAMOUNTINFDCRCY5
|
PSRTRLBALITM-AMOUNTINFREEDEFINEDCURRENCY5 table field -
▼
Description: Field Name: AMOUNTINFREEDEFINEDCURRENCY5 Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINFREEDEFINEDCURRENCY5
|
PSRTRLBALITM-DEBITAMOUNTINFREEDFNDCRCY5 table field - Debit Amount in Free Defined Currency 5
▼
Description: Debit Amount in Free Defined Currency 5 Field Name: DEBITAMOUNTINFREEDFNDCRCY5 Data Element: FIS_DR_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITAMOUNTINFREEDFNDCRCY5
|
PSRTRLBALITM-CREDITAMOUNTINFREEDFNDCRCY5 table field - Credit Amount in Free Defined Currency 5
▼
Description: Credit Amount in Free Defined Currency 5 Field Name: CREDITAMOUNTINFREEDFNDCRCY5 Data Element: FIS_CR_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITAMOUNTINFREEDFNDCRCY5
|
PSRTRLBALITM-ENDINGBALAMTINFREEDFNDCRCY5 table field - Ending Balance in Company Code Currency
▼
Description: Ending Balance in Company Code Currency Field Name: ENDINGBALAMTINFREEDFNDCRCY5 Data Element: FIS_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENDINGBALAMTINFREEDFNDCRCY5
|
PSRTRLBALITM-DEBITENDINGBALAMOUNTINFDCRCY5 table field - Debit Ending Balance Amount in Freely Defined Currency 5
▼
Description: Debit Ending Balance Amount in Freely Defined Currency 5 Field Name: DEBITENDINGBALAMOUNTINFDCRCY5 Data Element: GLO_DR_END_BAL_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITENDINGBALAMOUNTINFDCRCY5
|
PSRTRLBALITM-CREDITENDINGBALAMOUNTINFDCRCY5 table field - Credit Ending Balance Amount in Freely Defined Currency 5
▼
Description: Credit Ending Balance Amount in Freely Defined Currency 5 Field Name: CREDITENDINGBALAMOUNTINFDCRCY5 Data Element: GLO_CR_END_BAL_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITENDINGBALAMOUNTINFDCRCY5
|
PSRTRLBALITM-YEARTODATEAMOUNTINFDCRCY5 table field - Year to Date Amount in Company Code Currency
▼
Description: Year to Date Amount in Company Code Currency Field Name: YEARTODATEAMOUNTINFDCRCY5 Data Element: GLO_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YEARTODATEAMOUNTINFDCRCY5
|
PSRTRLBALITM-DEBITYTDAMOUNTINFDCRCY5 table field - Debit Year to Date Amount in Freely Defined Currency 5
▼
Description: Debit Year to Date Amount in Freely Defined Currency 5 Field Name: DEBITYTDAMOUNTINFDCRCY5 Data Element: GLO_DR_CYTD_BAL_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITYTDAMOUNTINFDCRCY5
|
PSRTRLBALITM-CREDITYTDAMOUNTINFDCRCY5 table field - Credit Year to Date Amount in Freely Defined Currency 5
▼
Description: Credit Year to Date Amount in Freely Defined Currency 5 Field Name: CREDITYTDAMOUNTINFDCRCY5 Data Element: GLO_CR_CYTD_BAL_DSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITYTDAMOUNTINFDCRCY5
|
PSRTRLBALITM-FREEDEFINEDCURRENCY6 table field - Freely Defined Currency 6
▼
Description: Freely Defined Currency 6 Field Name: FREEDEFINEDCURRENCY6 Data Element: FIS_CURR6 Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FREEDEFINEDCURRENCY6
|
PSRTRLBALITM-CARRYFWDBALAMOUNTINFDCRCY6 table field - Carry Forward Balance Amount in Freely Defined Crcy 6
▼
Description: Carry Forward Balance Amount in Freely Defined Crcy 6 Field Name: CARRYFWDBALAMOUNTINFDCRCY6 Data Element: GLO_CFWD_BAL_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CARRYFWDBALAMOUNTINFDCRCY6
|
PSRTRLBALITM-DEBITCARRYFWDBALAMTINFDCRCY6 table field - Debit Carry Forward Balance Amount in Freely Defined Crcy 6
▼
Description: Debit Carry Forward Balance Amount in Freely Defined Crcy 6 Field Name: DEBITCARRYFWDBALAMTINFDCRCY6 Data Element: GLO_DR_CFWD_BAL_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCARRYFWDBALAMTINFDCRCY6
|
PSRTRLBALITM-CREDITCARRYFWDBALAMTINFDCRCY6 table field - Credit Carry Forward Balance Amount in Freely Defined Crcy 6
▼
Description: Credit Carry Forward Balance Amount in Freely Defined Crcy 6 Field Name: CREDITCARRYFWDBALAMTINFDCRCY6 Data Element: GLO_CR_CFWD_BAL_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITCARRYFWDBALAMTINFDCRCY6
|
PSRTRLBALITM-PREVPERDYTDAMOUNTINFDCRCY6 table field - Previous Period YTD Amount in Company Code Currency
▼
Description: Previous Period YTD Amount in Company Code Currency Field Name: PREVPERDYTDAMOUNTINFDCRCY6 Data Element: GLO_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVPERDYTDAMOUNTINFDCRCY6
|
PSRTRLBALITM-DEBITPREVPERDYTDAMTINFDCRCY6 table field - Debit Previous Period YTD Amount in Freely Defined Crcy 6
▼
Description: Debit Previous Period YTD Amount in Freely Defined Crcy 6 Field Name: DEBITPREVPERDYTDAMTINFDCRCY6 Data Element: GLO_DR_YTD_BAL_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITPREVPERDYTDAMTINFDCRCY6
|
PSRTRLBALITM-CREDITPREVPERDYTDAMTINFDCRCY6 table field - Credit Previous Period YTD Amount in Freely Defined Crcy 6
▼
Description: Credit Previous Period YTD Amount in Freely Defined Crcy 6 Field Name: CREDITPREVPERDYTDAMTINFDCRCY6 Data Element: GLO_CR_YTD_BAL_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITPREVPERDYTDAMTINFDCRCY6
|
PSRTRLBALITM-STRTGBALAMTINFREEDFNDCRCY6 table field - Starting Balance in Company Code Currency
▼
Description: Starting Balance in Company Code Currency Field Name: STRTGBALAMTINFREEDFNDCRCY6 Data Element: FIS_START_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STRTGBALAMTINFREEDFNDCRCY6
|
PSRTRLBALITM-DEBITSTARTBALAMOUNTINFDCRCY6 table field - Debit Starting Balance Amount in Freely Defined Currency 6
▼
Description: Debit Starting Balance Amount in Freely Defined Currency 6 Field Name: DEBITSTARTBALAMOUNTINFDCRCY6 Data Element: GLO_DR_STRT_BAL_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITSTARTBALAMOUNTINFDCRCY6
|
PSRTRLBALITM-CREDITSTARTBALAMOUNTINFDCRCY6 table field - Credit Starting Balance Amount in Freely Defined Currency 6
▼
Description: Credit Starting Balance Amount in Freely Defined Currency 6 Field Name: CREDITSTARTBALAMOUNTINFDCRCY6 Data Element: GLO_CR_STRT_BAL_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITSTARTBALAMOUNTINFDCRCY6
|
PSRTRLBALITM-AMOUNTINFREEDEFINEDCURRENCY6 table field -
▼
Description: Field Name: AMOUNTINFREEDEFINEDCURRENCY6 Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINFREEDEFINEDCURRENCY6
|
PSRTRLBALITM-DEBITAMOUNTINFREEDFNDCRCY6 table field - Debit Amount in Free Defined Currency 6
▼
Description: Debit Amount in Free Defined Currency 6 Field Name: DEBITAMOUNTINFREEDFNDCRCY6 Data Element: FIS_DR_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITAMOUNTINFREEDFNDCRCY6
|
PSRTRLBALITM-CREDITAMOUNTINFREEDFNDCRCY6 table field - Credit Amount in Free Defined Currency 6
▼
Description: Credit Amount in Free Defined Currency 6 Field Name: CREDITAMOUNTINFREEDFNDCRCY6 Data Element: FIS_CR_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITAMOUNTINFREEDFNDCRCY6
|
PSRTRLBALITM-ENDINGBALAMTINFREEDFNDCRCY6 table field - Ending Balance in Company Code Currency
▼
Description: Ending Balance in Company Code Currency Field Name: ENDINGBALAMTINFREEDFNDCRCY6 Data Element: FIS_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENDINGBALAMTINFREEDFNDCRCY6
|
PSRTRLBALITM-DEBITENDINGBALAMOUNTINFDCRCY6 table field - Debit Ending Balance Amount in Freely Defined Currency 6
▼
Description: Debit Ending Balance Amount in Freely Defined Currency 6 Field Name: DEBITENDINGBALAMOUNTINFDCRCY6 Data Element: GLO_DR_END_BAL_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITENDINGBALAMOUNTINFDCRCY6
|
PSRTRLBALITM-CREDITENDINGBALAMOUNTINFDCRCY6 table field - Credit Ending Balance Amount in Freely Defined Currency 6
▼
Description: Credit Ending Balance Amount in Freely Defined Currency 6 Field Name: CREDITENDINGBALAMOUNTINFDCRCY6 Data Element: GLO_CR_END_BAL_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITENDINGBALAMOUNTINFDCRCY6
|
PSRTRLBALITM-YEARTODATEAMOUNTINFDCRCY6 table field - Year to Date Amount in Company Code Currency
▼
Description: Year to Date Amount in Company Code Currency Field Name: YEARTODATEAMOUNTINFDCRCY6 Data Element: GLO_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YEARTODATEAMOUNTINFDCRCY6
|
PSRTRLBALITM-DEBITYTDAMOUNTINFDCRCY6 table field - Debit Year to Date Amount in Freely Defined Currency 6
▼
Description: Debit Year to Date Amount in Freely Defined Currency 6 Field Name: DEBITYTDAMOUNTINFDCRCY6 Data Element: GLO_DR_CYTD_BAL_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITYTDAMOUNTINFDCRCY6
|
PSRTRLBALITM-CREDITYTDAMOUNTINFDCRCY6 table field - Credit Year to Date Amount in Freely Defined Currency 6
▼
Description: Credit Year to Date Amount in Freely Defined Currency 6 Field Name: CREDITYTDAMOUNTINFDCRCY6 Data Element: GLO_CR_CYTD_BAL_ESL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITYTDAMOUNTINFDCRCY6
|
PSRTRLBALITM-FREEDEFINEDCURRENCY7 table field - Freely Defined Currency 7
▼
Description: Freely Defined Currency 7 Field Name: FREEDEFINEDCURRENCY7 Data Element: FIS_RFCUR Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FREEDEFINEDCURRENCY7
|
PSRTRLBALITM-CARRYFWDBALAMOUNTINFDCRCY7 table field - Carry Forward Balance Amount in Freely Defined Crcy 7
▼
Description: Carry Forward Balance Amount in Freely Defined Crcy 7 Field Name: CARRYFWDBALAMOUNTINFDCRCY7 Data Element: GLO_CFWD_BAL_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CARRYFWDBALAMOUNTINFDCRCY7
|
PSRTRLBALITM-DEBITCARRYFWDBALAMTINFDCRCY7 table field - Debit Carry Forward Balance Amount in Freely Defined Crcy 7
▼
Description: Debit Carry Forward Balance Amount in Freely Defined Crcy 7 Field Name: DEBITCARRYFWDBALAMTINFDCRCY7 Data Element: GLO_DR_CFWD_BAL_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCARRYFWDBALAMTINFDCRCY7
|
PSRTRLBALITM-CREDITCARRYFWDBALAMTINFDCRCY7 table field - Credit Carry Forward Balance Amount in Freely Defined Crcy 7
▼
Description: Credit Carry Forward Balance Amount in Freely Defined Crcy 7 Field Name: CREDITCARRYFWDBALAMTINFDCRCY7 Data Element: GLO_CR_CFWD_BAL_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITCARRYFWDBALAMTINFDCRCY7
|
PSRTRLBALITM-PREVPERDYTDAMOUNTINFDCRCY7 table field - Previous Period YTD Amount in Company Code Currency
▼
Description: Previous Period YTD Amount in Company Code Currency Field Name: PREVPERDYTDAMOUNTINFDCRCY7 Data Element: GLO_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVPERDYTDAMOUNTINFDCRCY7
|
PSRTRLBALITM-DEBITPREVPERDYTDAMTINFDCRCY7 table field - Debit Previous Period YTD Amount in Freely Defined Crcy 7
▼
Description: Debit Previous Period YTD Amount in Freely Defined Crcy 7 Field Name: DEBITPREVPERDYTDAMTINFDCRCY7 Data Element: GLO_DR_YTD_BAL_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITPREVPERDYTDAMTINFDCRCY7
|
PSRTRLBALITM-CREDITPREVPERDYTDAMTINFDCRCY7 table field - Credit Previous Period YTD Amount in Freely Defined Crcy 7
▼
Description: Credit Previous Period YTD Amount in Freely Defined Crcy 7 Field Name: CREDITPREVPERDYTDAMTINFDCRCY7 Data Element: GLO_CR_YTD_BAL_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITPREVPERDYTDAMTINFDCRCY7
|
PSRTRLBALITM-STRTGBALAMTINFREEDFNDCRCY7 table field - Starting Balance in Company Code Currency
▼
Description: Starting Balance in Company Code Currency Field Name: STRTGBALAMTINFREEDFNDCRCY7 Data Element: FIS_START_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STRTGBALAMTINFREEDFNDCRCY7
|
PSRTRLBALITM-DEBITSTARTBALAMOUNTINFDCRCY7 table field - Debit Starting Balance Amount in Freely Defined Currency 7
▼
Description: Debit Starting Balance Amount in Freely Defined Currency 7 Field Name: DEBITSTARTBALAMOUNTINFDCRCY7 Data Element: GLO_DR_STRT_BAL_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITSTARTBALAMOUNTINFDCRCY7
|
PSRTRLBALITM-CREDITSTARTBALAMOUNTINFDCRCY7 table field - Credit Starting Balance Amount in Freely Defined Currency 7
▼
Description: Credit Starting Balance Amount in Freely Defined Currency 7 Field Name: CREDITSTARTBALAMOUNTINFDCRCY7 Data Element: GLO_CR_STRT_BAL_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITSTARTBALAMOUNTINFDCRCY7
|
PSRTRLBALITM-AMOUNTINFREEDEFINEDCURRENCY7 table field -
▼
Description: Field Name: AMOUNTINFREEDEFINEDCURRENCY7 Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINFREEDEFINEDCURRENCY7
|
PSRTRLBALITM-DEBITAMOUNTINFREEDFNDCRCY7 table field - Debit Amount in Free Defined Currency 7
▼
Description: Debit Amount in Free Defined Currency 7 Field Name: DEBITAMOUNTINFREEDFNDCRCY7 Data Element: FIS_DR_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITAMOUNTINFREEDFNDCRCY7
|
PSRTRLBALITM-CREDITAMOUNTINFREEDFNDCRCY7 table field - Credit Amount in Free Defined Currency 7
▼
Description: Credit Amount in Free Defined Currency 7 Field Name: CREDITAMOUNTINFREEDFNDCRCY7 Data Element: FIS_CR_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITAMOUNTINFREEDFNDCRCY7
|
PSRTRLBALITM-ENDINGBALAMTINFREEDFNDCRCY7 table field - Ending Balance in Company Code Currency
▼
Description: Ending Balance in Company Code Currency Field Name: ENDINGBALAMTINFREEDFNDCRCY7 Data Element: FIS_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENDINGBALAMTINFREEDFNDCRCY7
|
PSRTRLBALITM-DEBITENDINGBALAMOUNTINFDCRCY7 table field - Debit Ending Balance Amount in Freely Defined Currency 7
▼
Description: Debit Ending Balance Amount in Freely Defined Currency 7 Field Name: DEBITENDINGBALAMOUNTINFDCRCY7 Data Element: GLO_DR_END_BAL_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITENDINGBALAMOUNTINFDCRCY7
|
PSRTRLBALITM-CREDITENDINGBALAMOUNTINFDCRCY7 table field - Credit Ending Balance Amount in Freely Defined Currency 7
▼
Description: Credit Ending Balance Amount in Freely Defined Currency 7 Field Name: CREDITENDINGBALAMOUNTINFDCRCY7 Data Element: GLO_CR_END_BAL_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITENDINGBALAMOUNTINFDCRCY7
|
PSRTRLBALITM-YEARTODATEAMOUNTINFDCRCY7 table field - Year to Date Amount in Company Code Currency
▼
Description: Year to Date Amount in Company Code Currency Field Name: YEARTODATEAMOUNTINFDCRCY7 Data Element: GLO_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YEARTODATEAMOUNTINFDCRCY7
|
PSRTRLBALITM-DEBITYTDAMOUNTINFDCRCY7 table field - Debit Year to Date Amount in Freely Defined Currency 7
▼
Description: Debit Year to Date Amount in Freely Defined Currency 7 Field Name: DEBITYTDAMOUNTINFDCRCY7 Data Element: GLO_DR_CYTD_BAL_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITYTDAMOUNTINFDCRCY7
|
PSRTRLBALITM-CREDITYTDAMOUNTINFDCRCY7 table field - Credit Year to Date Amount in Freely Defined Currency 7
▼
Description: Credit Year to Date Amount in Freely Defined Currency 7 Field Name: CREDITYTDAMOUNTINFDCRCY7 Data Element: GLO_CR_CYTD_BAL_FSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITYTDAMOUNTINFDCRCY7
|
PSRTRLBALITM-FREEDEFINEDCURRENCY8 table field - Freely Defined Currency 8
▼
Description: Freely Defined Currency 8 Field Name: FREEDEFINEDCURRENCY8 Data Element: FIS_CURR8 Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FREEDEFINEDCURRENCY8
|
PSRTRLBALITM-CARRYFWDBALAMOUNTINFDCRCY8 table field - Carry Forward Balance Amount in Freely Defined Crcy 8
▼
Description: Carry Forward Balance Amount in Freely Defined Crcy 8 Field Name: CARRYFWDBALAMOUNTINFDCRCY8 Data Element: GLO_CFWD_BAL_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CARRYFWDBALAMOUNTINFDCRCY8
|
PSRTRLBALITM-DEBITCARRYFWDBALAMTINFDCRCY8 table field - Debit Carry Forward Balance Amount in Freely Defined Crcy 8
▼
Description: Debit Carry Forward Balance Amount in Freely Defined Crcy 8 Field Name: DEBITCARRYFWDBALAMTINFDCRCY8 Data Element: GLO_DR_CFWD_BAL_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITCARRYFWDBALAMTINFDCRCY8
|
PSRTRLBALITM-CREDITCARRYFWDBALAMTINFDCRCY8 table field - Credit Carry Forward Balance Amount in Freely Defined Crcy 8
▼
Description: Credit Carry Forward Balance Amount in Freely Defined Crcy 8 Field Name: CREDITCARRYFWDBALAMTINFDCRCY8 Data Element: GLO_CR_CFWD_BAL_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITCARRYFWDBALAMTINFDCRCY8
|
PSRTRLBALITM-PREVPERDYTDAMOUNTINFDCRCY8 table field - Previous Period YTD Amount in Company Code Currency
▼
Description: Previous Period YTD Amount in Company Code Currency Field Name: PREVPERDYTDAMOUNTINFDCRCY8 Data Element: GLO_YTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVPERDYTDAMOUNTINFDCRCY8
|
PSRTRLBALITM-DEBITPREVPERDYTDAMTINFDCRCY8 table field - Debit Previous Period YTD Amount in Freely Defined Crcy 8
▼
Description: Debit Previous Period YTD Amount in Freely Defined Crcy 8 Field Name: DEBITPREVPERDYTDAMTINFDCRCY8 Data Element: GLO_DR_YTD_BAL_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITPREVPERDYTDAMTINFDCRCY8
|
PSRTRLBALITM-CREDITPREVPERDYTDAMTINFDCRCY8 table field - Credit Previous Period YTD Amount in Freely Defined Crcy 8
▼
Description: Credit Previous Period YTD Amount in Freely Defined Crcy 8 Field Name: CREDITPREVPERDYTDAMTINFDCRCY8 Data Element: GLO_CR_YTD_BAL_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITPREVPERDYTDAMTINFDCRCY8
|
PSRTRLBALITM-STRTGBALAMTINFREEDFNDCRCY8 table field - Starting Balance in Company Code Currency
▼
Description: Starting Balance in Company Code Currency Field Name: STRTGBALAMTINFREEDFNDCRCY8 Data Element: FIS_START_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STRTGBALAMTINFREEDFNDCRCY8
|
PSRTRLBALITM-DEBITSTARTBALAMOUNTINFDCRCY8 table field - Debit Starting Balance Amount in Freely Defined Currency 8
▼
Description: Debit Starting Balance Amount in Freely Defined Currency 8 Field Name: DEBITSTARTBALAMOUNTINFDCRCY8 Data Element: GLO_DR_STRT_BAL_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITSTARTBALAMOUNTINFDCRCY8
|
PSRTRLBALITM-CREDITSTARTBALAMOUNTINFDCRCY8 table field - Credit Starting Balance Amount in Freely Defined Currency 8
▼
Description: Credit Starting Balance Amount in Freely Defined Currency 8 Field Name: CREDITSTARTBALAMOUNTINFDCRCY8 Data Element: GLO_CR_STRT_BAL_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITSTARTBALAMOUNTINFDCRCY8
|
PSRTRLBALITM-AMOUNTINFREEDEFINEDCURRENCY8 table field -
▼
Description: Field Name: AMOUNTINFREEDEFINEDCURRENCY8 Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINFREEDEFINEDCURRENCY8
|
PSRTRLBALITM-DEBITAMOUNTINFREEDFNDCRCY8 table field - Debit Amount in Free Defined Currency 8
▼
Description: Debit Amount in Free Defined Currency 8 Field Name: DEBITAMOUNTINFREEDFNDCRCY8 Data Element: FIS_DR_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITAMOUNTINFREEDFNDCRCY8
|
PSRTRLBALITM-CREDITAMOUNTINFREEDFNDCRCY8 table field - Credit Amount in Free Defined Currency 8
▼
Description: Credit Amount in Free Defined Currency 8 Field Name: CREDITAMOUNTINFREEDFNDCRCY8 Data Element: FIS_CR_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITAMOUNTINFREEDFNDCRCY8
|
PSRTRLBALITM-ENDINGBALAMTINFREEDFNDCRCY8 table field - Ending Balance in Company Code Currency
▼
Description: Ending Balance in Company Code Currency Field Name: ENDINGBALAMTINFREEDFNDCRCY8 Data Element: FIS_END_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENDINGBALAMTINFREEDFNDCRCY8
|
PSRTRLBALITM-DEBITENDINGBALAMOUNTINFDCRCY8 table field - Debit Ending Balance Amount in Freely Defined Currency 8
▼
Description: Debit Ending Balance Amount in Freely Defined Currency 8 Field Name: DEBITENDINGBALAMOUNTINFDCRCY8 Data Element: GLO_DR_END_BAL_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITENDINGBALAMOUNTINFDCRCY8
|
PSRTRLBALITM-CREDITENDINGBALAMOUNTINFDCRCY8 table field - Credit Ending Balance Amount in Freely Defined Currency 8
▼
Description: Credit Ending Balance Amount in Freely Defined Currency 8 Field Name: CREDITENDINGBALAMOUNTINFDCRCY8 Data Element: GLO_CR_END_BAL_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITENDINGBALAMOUNTINFDCRCY8
|
PSRTRLBALITM-YEARTODATEAMOUNTINFDCRCY8 table field - Year to Date Amount in Company Code Currency
▼
Description: Year to Date Amount in Company Code Currency Field Name: YEARTODATEAMOUNTINFDCRCY8 Data Element: GLO_CYTD_BAL_HSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YEARTODATEAMOUNTINFDCRCY8
|
PSRTRLBALITM-DEBITYTDAMOUNTINFDCRCY8 table field - Debit Year to Date Amount in Freely Defined Currency 8
▼
Description: Debit Year to Date Amount in Freely Defined Currency 8 Field Name: DEBITYTDAMOUNTINFDCRCY8 Data Element: GLO_DR_CYTD_BAL_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEBITYTDAMOUNTINFDCRCY8
|
PSRTRLBALITM-CREDITYTDAMOUNTINFDCRCY8 table field - Credit Year to Date Amount in Freely Defined Currency 8
▼
Description: Credit Year to Date Amount in Freely Defined Currency 8 Field Name: CREDITYTDAMOUNTINFDCRCY8 Data Element: GLO_CR_CYTD_BAL_GSL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREDITYTDAMOUNTINFDCRCY8
|
PSRTRLBALITM-ASSIGNMENTREFERENCE table field - Assignment Reference
▼
Description: Assignment Reference Field Name: ASSIGNMENTREFERENCE Data Element: FIS_ZUONR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ASSIGNMENTREFERENCE
|
PSRTRLBALITM-DOCUMENTITEMTEXT table field - Item Text
▼
Description: Item Text Field Name: DOCUMENTITEMTEXT Data Element: FARP_SGTXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTITEMTEXT
|