Details |
PPMRP_QUICKVIEW-MRPPLANT table field - Plant
▼
Description: Plant Field Name: MRPPLANT Data Element: WERKS_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field MRPPLANT
|
PPMRP_QUICKVIEW-MRPPLANT_NAME table field - Name
▼
Description: Name Field Name: MRPPLANT_NAME Data Element: NAME1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPPLANT_NAME
|
PPMRP_QUICKVIEW-MRPCONTROLLER table field - MRP Controller
▼
Description: MRP Controller Field Name: MRPCONTROLLER Data Element: DISPO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: DGR AppClass: SHLP: HS_T024D SHLP Field: DISPO ConvExit: See all SAP tables containing field MRPCONTROLLER
|
PPMRP_QUICKVIEW-MRPCONTROLLER_NAME table field - Name of MRP controller
▼
Description: Name of MRP controller Field Name: MRPCONTROLLER_NAME Data Element: DSNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPCONTROLLER_NAME
|
PPMRP_QUICKVIEW-MATERIALID table field - Material Number
▼
Description: Material Number Field Name: MATERIALID Data Element: MATNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field MATERIALID
|
PPMRP_QUICKVIEW-VENDORMATERIAL table field - Material Number Used by Supplier
▼
Description: Material Number Used by Supplier Field Name: VENDORMATERIAL Data Element: IDNLF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VENDORMATERIAL
|
PPMRP_QUICKVIEW-CHANGE_STATE_ID table field - Change State ID (Hash)
▼
Description: Change State ID (Hash) Field Name: CHANGE_STATE_ID Data Element: PPMRP_CHANGE_STATE_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHANGE_STATE_ID
|
PPMRP_QUICKVIEW-OUTLINE_AGREEMENT table field - Number of principal purchase agreement
▼
Description: Number of principal purchase agreement Field Name: OUTLINE_AGREEMENT Data Element: KONNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: KTR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OUTLINE_AGREEMENT
|
PPMRP_QUICKVIEW-OUTLINE_AGMT_ITEM table field - Item Number of Principal Purchase Agreement
▼
Description: Item Number of Principal Purchase Agreement Field Name: OUTLINE_AGMT_ITEM Data Element: KTPNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OUTLINE_AGMT_ITEM
|
PPMRP_QUICKVIEW-OUTLINE_AGMT_TYPE table field - Short Description of Purchasing Document Type
▼
Description: Short Description of Purchasing Document Type Field Name: OUTLINE_AGMT_TYPE Data Element: BATXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OUTLINE_AGMT_TYPE
|
PPMRP_QUICKVIEW-PLAN_DEL_TIME table field - Staging Time in Days
▼
Description: Staging Time in Days Field Name: PLAN_DEL_TIME Data Element: WRF_PSCD_MST Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLAN_DEL_TIME
|
PPMRP_QUICKVIEW-STAGING_TIME table field - Staging Time in Days
▼
Description: Staging Time in Days Field Name: STAGING_TIME Data Element: WRF_PSCD_MST Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STAGING_TIME
|
PPMRP_QUICKVIEW-NRM_PO_QTY table field - Standard Purchase Order Quantity
▼
Description: Standard Purchase Order Quantity Field Name: NRM_PO_QTY Data Element: NORBM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NRM_PO_QTY
|
PPMRP_QUICKVIEW-MAX_PO_QTY table field - Maximum Purchase Order Quantity
▼
Description: Maximum Purchase Order Quantity Field Name: MAX_PO_QTY Data Element: MAXBM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAX_PO_QTY
|
PPMRP_QUICKVIEW-MIN_PO_QTY table field - Minimum Purchase Order Quantity
▼
Description: Minimum Purchase Order Quantity Field Name: MIN_PO_QTY Data Element: MINBM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MIN_PO_QTY
|
PPMRP_QUICKVIEW-ACKN_REQD table field - Order Acknowledgment Requirement
▼
Description: Order Acknowledgment Requirement Field Name: ACKN_REQD Data Element: KZABS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACKN_REQD
|
PPMRP_QUICKVIEW-TOTAL_QUANTITY table field - Purchase requisition quantity
▼
Description: Purchase requisition quantity Field Name: TOTAL_QUANTITY Data Element: BAMNG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TOTAL_QUANTITY
|
PPMRP_QUICKVIEW-ORDERED_QUANTITY table field - Purchase Order Quantity
▼
Description: Purchase Order Quantity Field Name: ORDERED_QUANTITY Data Element: BSTMG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERED_QUANTITY
|
PPMRP_QUICKVIEW-OPEN_QUANTITY table field - Open Quantity
▼
Description: Open Quantity Field Name: OPEN_QUANTITY Data Element: OBMNG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OPEN_QUANTITY
|
PPMRP_QUICKVIEW-CONFIRMED_QUANTITY table field - Confirmed Quantity
▼
Description: Confirmed Quantity Field Name: CONFIRMED_QUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONFIRMED_QUANTITY
|
PPMRP_QUICKVIEW-PO_OPEN_ITEM_QUANTITY table field - Open Quantity
▼
Description: Open Quantity Field Name: PO_OPEN_ITEM_QUANTITY Data Element: OBMNG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PO_OPEN_ITEM_QUANTITY
|
PPMRP_QUICKVIEW-PURCHASE_REQ_FIRMED table field - Indicator: Fixing of Lot Size in Planned Order
▼
Description: Indicator: Fixing of Lot Size in Planned Order Field Name: PURCHASE_REQ_FIRMED Data Element: FIX01 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASE_REQ_FIRMED
|
PPMRP_QUICKVIEW-DELIVERY_DATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: DELIVERY_DATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DELIVERY_DATE
|
PPMRP_QUICKVIEW-RELEASE_DATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: RELEASE_DATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RELEASE_DATE
|
PPMRP_QUICKVIEW-GR_PR_TIME table field - Goods receipt processing time in days
▼
Description: Goods receipt processing time in days Field Name: GR_PR_TIME Data Element: WEBAZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GR_PR_TIME
|
PPMRP_QUICKVIEW-SUPPLYING_PLANT table field - Supplying (issuing) plant in case of stock transport order
▼
Description: Supplying (issuing) plant in case of stock transport order Field Name: SUPPLYING_PLANT Data Element: RESWK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLYING_PLANT
|
PPMRP_QUICKVIEW-SUPPLYING_PLANT_NAME table field - Name
▼
Description: Name Field Name: SUPPLYING_PLANT_NAME Data Element: NAME1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLYING_PLANT_NAME
|
PPMRP_QUICKVIEW-VENDOR table field - Account Number of Supplier
▼
Description: Account Number of Supplier Field Name: VENDOR Data Element: LIFNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: LIF AppClass: SHLP: KRED_C SHLP Field: LIFNR ConvExit: See all SAP tables containing field VENDOR
|
PPMRP_QUICKVIEW-VENDOR_NAME table field - Name 1
▼
Description: Name 1 Field Name: VENDOR_NAME Data Element: NAME1_GP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VENDOR_NAME
|
PPMRP_QUICKVIEW-VENDOR_FIXED table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: VENDOR_FIXED Data Element: BOOLEAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VENDOR_FIXED
|
PPMRP_QUICKVIEW-CUSTOMERMATERIAL table field - Material Number Used by Customer
▼
Description: Material Number Used by Customer Field Name: CUSTOMERMATERIAL Data Element: MATNR_KU Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMERMATERIAL
|
PPMRP_QUICKVIEW-MINDELQUANTITY table field - Minimum Delivery Quantity in Delivery Note Processing
▼
Description: Minimum Delivery Quantity in Delivery Note Processing Field Name: MINDELQUANTITY Data Element: MINLF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MINDELQUANTITY
|
PPMRP_QUICKVIEW-LOADINGDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: LOADINGDATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LOADINGDATE
|
PPMRP_QUICKVIEW-FIXED_DATE_QUANTITY table field - Delivery Date and Quantity Fixed
▼
Description: Delivery Date and Quantity Fixed Field Name: FIXED_DATE_QUANTITY Data Element: FIXMG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FIXED_DATE_QUANTITY
|
PPMRP_QUICKVIEW-COMPLETE_DELIVERY table field - Complete Delivery Defined for Each Sales Order
▼
Description: Complete Delivery Defined for Each Sales Order Field Name: COMPLETE_DELIVERY Data Element: AUTLF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPLETE_DELIVERY
|
PPMRP_QUICKVIEW-REQUESTEDDELDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: REQUESTEDDELDATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQUESTEDDELDATE
|
PPMRP_QUICKVIEW-DELIVERYBLOCKED table field - Delivery Block (Document Header)
▼
Description: Delivery Block (Document Header) Field Name: DELIVERYBLOCKED Data Element: LIFSK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DELIVERYBLOCKED
|
PPMRP_QUICKVIEW-DELIVERYBLOCK_DESC table field - Description
▼
Description: Description Field Name: DELIVERYBLOCK_DESC Data Element: BEZEI_LIFSP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DELIVERYBLOCK_DESC
|
PPMRP_QUICKVIEW-DELIVERYPRIO table field - Delivery Priority
▼
Description: Delivery Priority Field Name: DELIVERYPRIO Data Element: LPRIO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DELIVERYPRIO
|
PPMRP_QUICKVIEW-DELIVERYPRIODESC table field - Description
▼
Description: Description Field Name: DELIVERYPRIODESC Data Element: BEZEI20 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DELIVERYPRIODESC
|
PPMRP_QUICKVIEW-PARTIALDELALLOWED table field - Partial delivery at item level
▼
Description: Partial delivery at item level Field Name: PARTIALDELALLOWED Data Element: KZTLF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARTIALDELALLOWED
|
PPMRP_QUICKVIEW-PARTIALDELALLOWED_DESC table field - Explanatory Short Text
▼
Description: Explanatory Short Text Field Name: PARTIALDELALLOWED_DESC Data Element: DDTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARTIALDELALLOWED_DESC
|
PPMRP_QUICKVIEW-PARTIAL_MAX_DEL table field - Maximum Number of Partial Deliveries Allowed Per Item
▼
Description: Maximum Number of Partial Deliveries Allowed Per Item Field Name: PARTIAL_MAX_DEL Data Element: ANTLF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARTIAL_MAX_DEL
|
PPMRP_QUICKVIEW-CUSTOMER table field - Customer Number
▼
Description: Customer Number Field Name: CUSTOMER Data Element: KUNNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: KUN AppClass: SHLP: C_KUNNR SHLP Field: KUNNR ConvExit: See all SAP tables containing field CUSTOMER
|
PPMRP_QUICKVIEW-CUSTOMER_NAME table field - Name 1
▼
Description: Name 1 Field Name: CUSTOMER_NAME Data Element: NAME1_GP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMER_NAME
|
PPMRP_QUICKVIEW-SOLUTION_REQ_NOTE table field - Note for the Change Request
▼
Description: Note for the Change Request Field Name: SOLUTION_REQ_NOTE Data Element: MRPREQNOTE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOLUTION_REQ_NOTE
|
PPMRP_QUICKVIEW-SOLUTION_REQ_STATUS table field - Status of the Change Request
▼
Description: Status of the Change Request Field Name: SOLUTION_REQ_STATUS Data Element: MRPREQUESTSTATUS Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: MRPREQUESTSTATUS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOLUTION_REQ_STATUS
|
PPMRP_QUICKVIEW-DIVISION table field - Division
▼
Description: Division Field Name: DIVISION Data Element: SPART Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: SPA AppClass: SHLP: C_SPART SHLP Field: SPART ConvExit: See all SAP tables containing field DIVISION
|
PPMRP_QUICKVIEW-DIVISION_NAME table field - Name
▼
Description: Name Field Name: DIVISION_NAME Data Element: VTXTK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DIVISION_NAME
|
PPMRP_QUICKVIEW-MRPELEMENTCHGAVAILYORRQMTDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: MRPELEMENTCHGAVAILYORRQMTDATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPELEMENTCHGAVAILYORRQMTDATE
|
PPMRP_QUICKVIEW-MRPELEMENTCHANGEDDELTAQUANTITY table field - Total Quantity of Change Request in Order Unit
▼
Description: Total Quantity of Change Request in Order Unit Field Name: MRPELEMENTCHANGEDDELTAQUANTITY Data Element: MRPREQQUANTTOTAL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPELEMENTCHANGEDDELTAQUANTITY
|
PPMRP_QUICKVIEW-PURCHASINGGROUP table field - Purchasing Group
▼
Description: Purchasing Group Field Name: PURCHASINGGROUP Data Element: EKGRP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: EKG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGGROUP
|
PPMRP_QUICKVIEW-PURCHASINGGROUPNAME table field - Description of purchasing group
▼
Description: Description of purchasing group Field Name: PURCHASINGGROUPNAME Data Element: EKNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGGROUPNAME
|
PPMRP_QUICKVIEW-INTCONTACT_NAME table field - Full Name of Person
▼
Description: Full Name of Person Field Name: INTCONTACT_NAME Data Element: AD_NAMTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INTCONTACT_NAME
|
PPMRP_QUICKVIEW-INTCONTACT_TEL table field - First Cell Phone Number: Dialing Code + Number
▼
Description: First Cell Phone Number: Dialing Code + Number Field Name: INTCONTACT_TEL Data Element: AD_MBNMBR1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INTCONTACT_TEL
|
PPMRP_QUICKVIEW-INTCONTACT_EMAIL table field - E-Mail Address
▼
Description: E-Mail Address Field Name: INTCONTACT_EMAIL Data Element: AD_SMTPADR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INTCONTACT_EMAIL
|
PPMRP_QUICKVIEW-MATERIALPROCUREMENTCATEGORY table field - Procurement Type
▼
Description: Procurement Type Field Name: MATERIALPROCUREMENTCATEGORY Data Element: BESKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: MBS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALPROCUREMENTCATEGORY
|
PPMRP_QUICKVIEW-MATERIALPROCUREMENTCATNAME table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: MATERIALPROCUREMENTCATNAME Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALPROCUREMENTCATNAME
|
PPMRP_QUICKVIEW-MATERIALPROCUREMENTTYPE table field - Special procurement type
▼
Description: Special procurement type Field Name: MATERIALPROCUREMENTTYPE Data Element: SOBES Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALPROCUREMENTTYPE
|
PPMRP_QUICKVIEW-MATERIALPROCUREMENTTYPENAME table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: MATERIALPROCUREMENTTYPENAME Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALPROCUREMENTTYPENAME
|
PPMRP_QUICKVIEW-REQUIREMENTDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: REQUIREMENTDATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQUIREMENTDATE
|
PPMRP_QUICKVIEW-WITHDRAWNQUANTITY table field -
▼
Description: Field Name: WITHDRAWNQUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WITHDRAWNQUANTITY
|
PPMRP_QUICKVIEW-PRODUCTIONLINETEXT table field -
▼
Description: Field Name: PRODUCTIONLINETEXT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTIONLINETEXT
|
PPMRP_QUICKVIEW-PRODUCTIONVERSIONTEXT table field -
▼
Description: Field Name: PRODUCTIONVERSIONTEXT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTIONVERSIONTEXT
|
PPMRP_QUICKVIEW-SUPERIORORDER table field -
▼
Description: Field Name: SUPERIORORDER Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPERIORORDER
|
PPMRP_QUICKVIEW-SALESORDER table field -
▼
Description: Field Name: SALESORDER Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESORDER
|
PPMRP_QUICKVIEW-SALESORDERITEM table field -
▼
Description: Field Name: SALESORDERITEM Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESORDERITEM
|
PPMRP_QUICKVIEW-WBSELEMENT table field -
▼
Description: Field Name: WBSELEMENT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WBSELEMENT
|
PPMRP_QUICKVIEW-MATERIALROUNDINGPROFILE table field -
▼
Description: Field Name: MATERIALROUNDINGPROFILE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALROUNDINGPROFILE
|
PPMRP_QUICKVIEW-PLANNEDSCRAPQTY table field -
▼
Description: Field Name: PLANNEDSCRAPQTY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANNEDSCRAPQTY
|
PPMRP_QUICKVIEW-ISSUEDQUANTITY table field -
▼
Description: Field Name: ISSUEDQUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISSUEDQUANTITY
|
PPMRP_QUICKVIEW-GOODSRECEIPTQTY table field -
▼
Description: Field Name: GOODSRECEIPTQTY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GOODSRECEIPTQTY
|
PPMRP_QUICKVIEW-MRPELEMENTISEDITABLE table field -
▼
Description: Field Name: MRPELEMENTISEDITABLE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPELEMENTISEDITABLE
|
PPMRP_QUICKVIEW-PLANNEDORDER table field - Planned Order
▼
Description: Planned Order Field Name: PLANNEDORDER Data Element: PLNUM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PAF AppClass: SHLP: PLNUM SHLP Field: PLNUM ConvExit: See all SAP tables containing field PLANNEDORDER
|
PPMRP_QUICKVIEW-ORDEREDCHANGEDQUANTITY table field -
▼
Description: Field Name: ORDEREDCHANGEDQUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDEREDCHANGEDQUANTITY
|
PPMRP_QUICKVIEW-PURCHASEORDERUNIT table field - Do not use MEINS to avoid Gateway conversion
▼
Description: Do not use MEINS to avoid Gateway conversion Field Name: PURCHASEORDERUNIT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEORDERUNIT
|
PPMRP_QUICKVIEW-ORDEREXPECTEDDEVIATIONQUANTITY table field -
▼
Description: Field Name: ORDEREXPECTEDDEVIATIONQUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDEREXPECTEDDEVIATIONQUANTITY
|
PPMRP_QUICKVIEW-PRODUCTAVAILABILITYDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: PRODUCTAVAILABILITYDATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTAVAILABILITYDATE
|
PPMRP_QUICKVIEW-NOTIFIEDQUANTITY table field -
▼
Description: Field Name: NOTIFIEDQUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NOTIFIEDQUANTITY
|
PPMRP_QUICKVIEW-INTRANSITQUANTITY table field -
▼
Description: Field Name: INTRANSITQUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INTRANSITQUANTITY
|
PPMRP_QUICKVIEW-MFGORDERPROGRESSSTATUSNAME table field - Character field of length 40
▼
Description: Character field of length 40 Field Name: MFGORDERPROGRESSSTATUSNAME Data Element: CHAR40 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MFGORDERPROGRESSSTATUSNAME
|
PPMRP_QUICKVIEW-MFGORDERSCHEDULEDRELEASEDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: MFGORDERSCHEDULEDRELEASEDATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MFGORDERSCHEDULEDRELEASEDATE
|
PPMRP_QUICKVIEW-MFGORDERSCHEDULEDSTARTDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: MFGORDERSCHEDULEDSTARTDATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MFGORDERSCHEDULEDSTARTDATE
|
PPMRP_QUICKVIEW-MFGORDERSCHEDULEDENDDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: MFGORDERSCHEDULEDENDDATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MFGORDERSCHEDULEDENDDATE
|
PPMRP_QUICKVIEW-DOCUMENTDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: DOCUMENTDATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTDATE
|
PPMRP_QUICKVIEW-NUMERATOR table field - Numerator for Conversion to Base Units of Measure
▼
Description: Numerator for Conversion to Base Units of Measure Field Name: NUMERATOR Data Element: UMREZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMERATOR
|
PPMRP_QUICKVIEW-DENOMINATOR table field - Denominator for conversion to base units of measure
▼
Description: Denominator for conversion to base units of measure Field Name: DENOMINATOR Data Element: UMREN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DENOMINATOR
|
PPMRP_QUICKVIEW-ORDEREDQUANTITYINORDERUNIT table field -
▼
Description: Field Name: ORDEREDQUANTITYINORDERUNIT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDEREDQUANTITYINORDERUNIT
|
PPMRP_QUICKVIEW-COMMITTEDQUANTITY table field -
▼
Description: Field Name: COMMITTEDQUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMITTEDQUANTITY
|
PPMRP_QUICKVIEW-MANUFACTURINGORDER table field - MRP element number
▼
Description: MRP element number Field Name: MANUFACTURINGORDER Data Element: DEL12 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANUFACTURINGORDER
|
PPMRP_QUICKVIEW-ORDUNITOFMEASURECOMMERCIALNAME table field - External Unit of Measurement in Commercial Format (3-Char.)
▼
Description: External Unit of Measurement in Commercial Format (3-Char.) Field Name: ORDUNITOFMEASURECOMMERCIALNAME Data Element: MSEH3 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDUNITOFMEASURECOMMERCIALNAME
|
PPMRP_QUICKVIEW-PRODORDERIDISEXTERNAL table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: PRODORDERIDISEXTERNAL Data Element: BOOLEAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODORDERIDISEXTERNAL
|
PPMRP_QUICKVIEW-PROCORDERIDISEXTERNAL table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: PROCORDERIDISEXTERNAL Data Element: BOOLEAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROCORDERIDISEXTERNAL
|
PPMRP_QUICKVIEW-PURCHASEORDERROUNDINGPROFILE table field -
▼
Description: Field Name: PURCHASEORDERROUNDINGPROFILE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEORDERROUNDINGPROFILE
|
PPMRP_QUICKVIEW-PURCHASEORDERROUNDINGPROFNAME table field -
▼
Description: Field Name: PURCHASEORDERROUNDINGPROFNAME Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEORDERROUNDINGPROFNAME
|
PPMRP_QUICKVIEW-MAINTENANCEPLANNERGROUP table field - Planner Group for Customer Service and Plant Maintenance
▼
Description: Planner Group for Customer Service and Plant Maintenance Field Name: MAINTENANCEPLANNERGROUP Data Element: INGRP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: IHG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINTENANCEPLANNERGROUP
|
PPMRP_QUICKVIEW-MAINTENANCEPLANNERGROUPNAME table field - Name of the Maintenance Planner Group
▼
Description: Name of the Maintenance Planner Group Field Name: MAINTENANCEPLANNERGROUPNAME Data Element: INNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINTENANCEPLANNERGROUPNAME
|
PPMRP_QUICKVIEW-MAINTENANCEWORKCENTER table field - Main work center for maintenance tasks
▼
Description: Main work center for maintenance tasks Field Name: MAINTENANCEWORKCENTER Data Element: GEWRK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: VAP AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINTENANCEWORKCENTER
|
PPMRP_QUICKVIEW-MAINTENANCEWORKCENTERNAME table field - Short description
▼
Description: Short description Field Name: MAINTENANCEWORKCENTERNAME Data Element: CR_KTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINTENANCEWORKCENTERNAME
|
PPMRP_QUICKVIEW-MAINTENANCEORDERPRIORITY table field - Priority
▼
Description: Priority Field Name: MAINTENANCEORDERPRIORITY Data Element: PRIOK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PRIOK AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINTENANCEORDERPRIORITY
|
PPMRP_QUICKVIEW-MAINTENANCEPLANNINGPLANT table field - Plant
▼
Description: Plant Field Name: MAINTENANCEPLANNINGPLANT Data Element: WERKS_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field MAINTENANCEPLANNINGPLANT
|
PPMRP_QUICKVIEW-MAINTENANCEPLANNINGPLANTNAME table field - Name
▼
Description: Name Field Name: MAINTENANCEPLANNINGPLANTNAME Data Element: NAME1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINTENANCEPLANNINGPLANTNAME
|
PPMRP_QUICKVIEW-MAINTENANCEREVISION table field - Revision for Plant Maintenance and Customer Service
▼
Description: Revision for Plant Maintenance and Customer Service Field Name: MAINTENANCEREVISION Data Element: REVNI Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINTENANCEREVISION
|
PPMRP_QUICKVIEW-MAINTENANCENOTIFICATION table field - Notification Number
▼
Description: Notification Number Field Name: MAINTENANCENOTIFICATION Data Element: QMNUM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: IQM AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINTENANCENOTIFICATION
|
PPMRP_QUICKVIEW-ACTIVITYTYPE table field - Maintenance activity type
▼
Description: Maintenance activity type Field Name: ACTIVITYTYPE Data Element: ILA Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: H_T350I SHLP Field: ILART ConvExit: See all SAP tables containing field ACTIVITYTYPE
|
PPMRP_QUICKVIEW-ACTIVITYTYPEDESC table field - Description of maintenance activity type
▼
Description: Description of maintenance activity type Field Name: ACTIVITYTYPEDESC Data Element: ILATX Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTIVITYTYPEDESC
|
PPMRP_QUICKVIEW-RESPONSIBLEPERSON table field - Partner
▼
Description: Partner Field Name: RESPONSIBLEPERSON Data Element: I_PARNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RESPONSIBLEPERSON
|
PPMRP_QUICKVIEW-INVENTORYSPECIALSTOCK table field - Special Stock Indicator
▼
Description: Special Stock Indicator Field Name: INVENTORYSPECIALSTOCK Data Element: SOBKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INVENTORYSPECIALSTOCK
|
PPMRP_QUICKVIEW-REFERENCEDOCUMENT table field - Document Number of Reference Document
▼
Description: Document Number of Reference Document Field Name: REFERENCEDOCUMENT Data Element: VGBEL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REFERENCEDOCUMENT
|
PPMRP_QUICKVIEW-REFERENCEDOCUMENTITEM table field - MRP Element Item (External)
▼
Description: MRP Element Item (External) Field Name: REFERENCEDOCUMENTITEM Data Element: PPMRP_ELEMITEM_EXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REFERENCEDOCUMENTITEM
|
PPMRP_QUICKVIEW-SALESORDERITEMMATERIAL table field - Material Number
▼
Description: Material Number Field Name: SALESORDERITEMMATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field SALESORDERITEMMATERIAL
|
PPMRP_QUICKVIEW-SALESORDERITEMMATERIALNAME table field - Material Description
▼
Description: Material Description Field Name: SALESORDERITEMMATERIALNAME Data Element: MAKTX Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESORDERITEMMATERIALNAME
|
PPMRP_QUICKVIEW-WBSELEMENTNAME table field - Work Breakdown Structure Element (WBS Element)
▼
Description: Work Breakdown Structure Element (WBS Element) Field Name: WBSELEMENTNAME Data Element: PS_POSID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PRO AppClass: SHLP: CC_PRPM SHLP Field: POSID ConvExit: See all SAP tables containing field WBSELEMENTNAME
|
PPMRP_QUICKVIEW-WBSDESCRIPTION table field - PS: Short description (1st text line)
▼
Description: PS: Short description (1st text line) Field Name: WBSDESCRIPTION Data Element: PS_POST1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WBSDESCRIPTION
|
PPMRP_QUICKVIEW-WBSRESPONSIBLEPERSON table field - Number of the Responsible Person (Project Manager)
▼
Description: Number of the Responsible Person (Project Manager) Field Name: WBSRESPONSIBLEPERSON Data Element: PS_VERNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WBSRESPONSIBLEPERSON
|
PPMRP_QUICKVIEW-WBSRESPONSIBLEPERSONNAME table field - Name of responsible person (Project manager)
▼
Description: Name of responsible person (Project manager) Field Name: WBSRESPONSIBLEPERSONNAME Data Element: PS_VERNA Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WBSRESPONSIBLEPERSONNAME
|
PPMRP_QUICKVIEW-PROJECT table field -
▼
Description: Field Name: PROJECT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROJECT
|
PPMRP_QUICKVIEW-PROJECTNAME table field - Project definition
▼
Description: Project definition Field Name: PROJECTNAME Data Element: PS_PSPID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PSP AppClass: SHLP: PD_DUMMY SHLP Field: PSPID ConvExit: See all SAP tables containing field PROJECTNAME
|
PPMRP_QUICKVIEW-PROJECTDESCRIPTION table field - PS: Short description (1st text line)
▼
Description: PS: Short description (1st text line) Field Name: PROJECTDESCRIPTION Data Element: PS_POST1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROJECTDESCRIPTION
|
PPMRP_QUICKVIEW-TOPLEVELORDER table field - Order Number
▼
Description: Order Number Field Name: TOPLEVELORDER Data Element: AUFNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: ANR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TOPLEVELORDER
|
PPMRP_QUICKVIEW-TOPLEVELORDERMATERIAL table field - Material Number
▼
Description: Material Number Field Name: TOPLEVELORDERMATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field TOPLEVELORDERMATERIAL
|
PPMRP_QUICKVIEW-TOPLEVELORDERMATERIALNAME table field - Material Description
▼
Description: Material Description Field Name: TOPLEVELORDERMATERIALNAME Data Element: MAKTX Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TOPLEVELORDERMATERIALNAME
|
PPMRP_QUICKVIEW-EXTERNALAPPROVALSTATUS table field - Character Field of Length 1
▼
Description: Character Field of Length 1 Field Name: EXTERNALAPPROVALSTATUS Data Element: CHAR01 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXTERNALAPPROVALSTATUS
|
PPMRP_QUICKVIEW-MATERIALSTATUS table field - Message if material is used in MRP
▼
Description: Message if material is used in MRP Field Name: MATERIALSTATUS Data Element: DDISP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALSTATUS
|
PPMRP_QUICKVIEW-MRPELEMENT_ID table field - MRP element number
▼
Description: MRP element number Field Name: MRPELEMENT_ID Data Element: DEL12 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPELEMENT_ID
|
PPMRP_QUICKVIEW-MRPELEMENTITEM_ID table field - MRP element item
▼
Description: MRP element item Field Name: MRPELEMENTITEM_ID Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPELEMENTITEM_ID
|
PPMRP_QUICKVIEW-MRPELEMENTSCHEDULELINE_ID table field - Schedule Line Number MRP Element
▼
Description: Schedule Line Number MRP Element Field Name: MRPELEMENTSCHEDULELINE_ID Data Element: DELET Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPELEMENTSCHEDULELINE_ID
|
PPMRP_QUICKVIEW-MRPELEMENTCATEGORY table field - MRP Element
▼
Description: MRP Element Field Name: MRPELEMENTCATEGORY Data Element: DELKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPELEMENTCATEGORY
|
PPMRP_QUICKVIEW-MRPELEMENTCATEGORY_SHORTNAME table field - Abbreviation for MRP element
▼
Description: Abbreviation for MRP element Field Name: MRPELEMENTCATEGORY_SHORTNAME Data Element: DELB0 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPELEMENTCATEGORY_SHORTNAME
|
PPMRP_QUICKVIEW-MRPELEMENT_ID_EXT table field - MRP element number
▼
Description: MRP element number Field Name: MRPELEMENT_ID_EXT Data Element: DEL12 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPELEMENT_ID_EXT
|
PPMRP_QUICKVIEW-MRPELEMENTITEM_ID_EXT table field - MRP Element Item (External)
▼
Description: MRP Element Item (External) Field Name: MRPELEMENTITEM_ID_EXT Data Element: PPMRP_ELEMITEM_EXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPELEMENTITEM_ID_EXT
|
PPMRP_QUICKVIEW-MRPELEMENTSCHEDULELINE_ID_EXT table field - MRP Element Schedule Line (External)
▼
Description: MRP Element Schedule Line (External) Field Name: MRPELEMENTSCHEDULELINE_ID_EXT Data Element: PPMRP_ELEMLINE_EXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPELEMENTSCHEDULELINE_ID_EXT
|
PPMRP_QUICKVIEW-UNITOFMEASURETECHNICALNAME table field - External Unit of Measurement in Technical Format (6-Char.)
▼
Description: External Unit of Measurement in Technical Format (6-Char.) Field Name: UNITOFMEASURETECHNICALNAME Data Element: MSEH6 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field UNITOFMEASURETECHNICALNAME
|
PPMRP_QUICKVIEW-UNITOFMEASURECOMMERCIALNAME table field - External Unit of Measurement in Commercial Format (3-Char.)
▼
Description: External Unit of Measurement in Commercial Format (3-Char.) Field Name: UNITOFMEASURECOMMERCIALNAME Data Element: MSEH3 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field UNITOFMEASURECOMMERCIALNAME
|
PPMRP_QUICKVIEW-TARGETQUANTITYUNITDCMLS table field - No. of decimal places for rounding
▼
Description: No. of decimal places for rounding Field Name: TARGETQUANTITYUNITDCMLS Data Element: ANDEC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TARGETQUANTITYUNITDCMLS
|
PPMRP_QUICKVIEW-ORDERQUANTITYUNITDCMLS table field - No. of decimal places for rounding
▼
Description: No. of decimal places for rounding Field Name: ORDERQUANTITYUNITDCMLS Data Element: ANDEC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERQUANTITYUNITDCMLS
|
PPMRP_QUICKVIEW-TARGETQUANTITYUNITDISPLAYDCMLS table field - Number of Decimal Places for Number Display
▼
Description: Number of Decimal Places for Number Display Field Name: TARGETQUANTITYUNITDISPLAYDCMLS Data Element: DECAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TARGETQUANTITYUNITDISPLAYDCMLS
|
PPMRP_QUICKVIEW-ORDERQUANTITYUNITDISPLAYDCMLS table field - Number of Decimal Places for Number Display
▼
Description: Number of Decimal Places for Number Display Field Name: ORDERQUANTITYUNITDISPLAYDCMLS Data Element: DECAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERQUANTITYUNITDISPLAYDCMLS
|
PPMRP_QUICKVIEW-CONTACT_NAME table field - Full Name of Person
▼
Description: Full Name of Person Field Name: CONTACT_NAME Data Element: AD_NAMTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTACT_NAME
|
PPMRP_QUICKVIEW-CONTACT_TEL table field - First Cell Phone Number: Dialing Code + Number
▼
Description: First Cell Phone Number: Dialing Code + Number Field Name: CONTACT_TEL Data Element: AD_MBNMBR1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTACT_TEL
|
PPMRP_QUICKVIEW-CONTACT_EMAIL table field - E-Mail Address
▼
Description: E-Mail Address Field Name: CONTACT_EMAIL Data Element: AD_SMTPADR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTACT_EMAIL
|
PPMRP_QUICKVIEW-QUICKVIEW_CATEGORY table field - Quickview Category (Sales Order, Purchase Order, ...)
▼
Description: Quickview Category (Sales Order, Purchase Order, ...) Field Name: QUICKVIEW_CATEGORY Data Element: PPMRP_QUICKVIEW_CATEGORY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field QUICKVIEW_CATEGORY
|
PPMRP_QUICKVIEW-PRODUCTION_SUPERVISOR table field - Production Supervisor
▼
Description: Production Supervisor Field Name: PRODUCTION_SUPERVISOR Data Element: FEVOR Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: CFV AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTION_SUPERVISOR
|
PPMRP_QUICKVIEW-PRODUCTION_SUPERVISOR_TXT table field - Production Supervisor Name
▼
Description: Production Supervisor Name Field Name: PRODUCTION_SUPERVISOR_TXT Data Element: TXT_FEVOR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTION_SUPERVISOR_TXT
|
PPMRP_QUICKVIEW-SYSTEM_STATUS table field - Object status
▼
Description: Object status Field Name: SYSTEM_STATUS Data Element: J_STATUS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SYSTEM_STATUS
|
PPMRP_QUICKVIEW-SYSTEM_STATUS_DESC table field - Individual Status of an Object
▼
Description: Individual Status of an Object Field Name: SYSTEM_STATUS_DESC Data Element: J_TXT30 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SYSTEM_STATUS_DESC
|
PPMRP_QUICKVIEW-ORDER_STARTDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: ORDER_STARTDATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDER_STARTDATE
|
PPMRP_QUICKVIEW-ORDER_FINISHDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: ORDER_FINISHDATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDER_FINISHDATE
|
PPMRP_QUICKVIEW-DELIVERED_QUANTITY table field - Delivered quantity
▼
Description: Delivered quantity Field Name: DELIVERED_QUANTITY Data Element: CO_GWEMG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DELIVERED_QUANTITY
|
PPMRP_QUICKVIEW-ORDER_PRIORITY table field - Order priority
▼
Description: Order priority Field Name: ORDER_PRIORITY Data Element: CO_APRIO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDER_PRIORITY
|
PPMRP_QUICKVIEW-PRODUCTION_VERSION table field - Production Version
▼
Description: Production Version Field Name: PRODUCTION_VERSION Data Element: VERID Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: VER AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTION_VERSION
|
PPMRP_QUICKVIEW-PRODUCTION_LINE table field - Work Center
▼
Description: Work Center Field Name: PRODUCTION_LINE Data Element: ARBPL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AGR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTION_LINE
|
PPMRP_QUICKVIEW-PRODUCTION_LINE_DESC table field - General Name
▼
Description: General Name Field Name: PRODUCTION_LINE_DESC Data Element: KTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTION_LINE_DESC
|
PPMRP_QUICKVIEW-PRODUCTION_PLANT table field - Planning Plant for an Order
▼
Description: Planning Plant for an Order Field Name: PRODUCTION_PLANT Data Element: CO_PWERK Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTION_PLANT
|
PPMRP_QUICKVIEW-PRODUCTION_PLANT_NAME table field - Name
▼
Description: Name Field Name: PRODUCTION_PLANT_NAME Data Element: NAME1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTION_PLANT_NAME
|
PPMRP_QUICKVIEW-ORDER_TYPE table field - Planned Order Type
▼
Description: Planned Order Type Field Name: ORDER_TYPE Data Element: PAART Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDER_TYPE
|
PPMRP_QUICKVIEW-ORDER_TYPE_DESCRIPTION table field - Individual Status of an Object
▼
Description: Individual Status of an Object Field Name: ORDER_TYPE_DESCRIPTION Data Element: J_TXT30 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDER_TYPE_DESCRIPTION
|
PPMRP_QUICKVIEW-PURCHASING_ORGANIZATION table field - Purchasing Organization
▼
Description: Purchasing Organization Field Name: PURCHASING_ORGANIZATION Data Element: EKORG Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: EKO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASING_ORGANIZATION
|
PPMRP_QUICKVIEW-OPENING_DATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: OPENING_DATE Data Element: TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OPENING_DATE
|
PPMRP_QUICKVIEW-INHOUSE_PRODUCTION_TIME table field - In-house production time
▼
Description: In-house production time Field Name: INHOUSE_PRODUCTION_TIME Data Element: DZEIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INHOUSE_PRODUCTION_TIME
|
PPMRP_QUICKVIEW-TOTAL_REPL_LEAD_TIME table field - Total replenishment lead time (in workdays)
▼
Description: Total replenishment lead time (in workdays) Field Name: TOTAL_REPL_LEAD_TIME Data Element: WZEIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TOTAL_REPL_LEAD_TIME
|
PPMRP_QUICKVIEW-FIXED_LOTSIZE table field - Fixed lot size
▼
Description: Fixed lot size Field Name: FIXED_LOTSIZE Data Element: BSTFE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FIXED_LOTSIZE
|
PPMRP_QUICKVIEW-MIN_LOTSIZE table field - Minimum Lot Size
▼
Description: Minimum Lot Size Field Name: MIN_LOTSIZE Data Element: BSTMI Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MIN_LOTSIZE
|
PPMRP_QUICKVIEW-MAX_LOTSIZE table field - Maximum Lot Size
▼
Description: Maximum Lot Size Field Name: MAX_LOTSIZE Data Element: BSTMA Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAX_LOTSIZE
|
PPMRP_QUICKVIEW-ROUNDING_VALUE table field - Rounding value for purchase order quantity
▼
Description: Rounding value for purchase order quantity Field Name: ROUNDING_VALUE Data Element: BSTRF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ROUNDING_VALUE
|
PPMRP_QUICKVIEW-ROUNDING_PROFILE table field - Rounding Profile
▼
Description: Rounding Profile Field Name: ROUNDING_PROFILE Data Element: RDPRF Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ROUNDING_PROFILE
|
PPMRP_QUICKVIEW-ROUNDING_PROFILE_DESC table field - Text, 40 Characters Long
▼
Description: Text, 40 Characters Long Field Name: ROUNDING_PROFILE_DESC Data Element: TEXT40 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ROUNDING_PROFILE_DESC
|
PPMRP_QUICKVIEW-DUMMY_MRP_QUICKVIEW table field - Dummy function in length 1
▼
Description: Dummy function in length 1 Field Name: DUMMY_MRP_QUICKVIEW Data Element: DUMMY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DUMMY_MRP_QUICKVIEW
|
PPMRP_QUICKVIEW-DUMMY_EBAN_INCL_EEW_PS table field - Data element for purchase requisition extensibility
▼
Description: Data element for purchase requisition extensibility Field Name: DUMMY_EBAN_INCL_EEW_PS Data Element: EBAN_INCL_EEW Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DUMMY_EBAN_INCL_EEW_PS
|
PPMRP_QUICKVIEW-DUMMY_EBAN_INCL_EEW_TR table field - Data element for purchase requisition extensibility
▼
Description: Data element for purchase requisition extensibility Field Name: DUMMY_EBAN_INCL_EEW_TR Data Element: EBAN_INCL_EEW Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DUMMY_EBAN_INCL_EEW_TR
|
PPMRP_QUICKVIEW-BASEUNITOFMEASURE table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: BASEUNITOFMEASURE Data Element: MEINS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASEUNITOFMEASURE
|
PPMRP_QUICKVIEW-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: LASTCHANGEDATETIME Data Element: TIMESTAMPL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDATETIME
|
PPMRP_QUICKVIEW-LASTCHANGEDATE table field -
▼
Description: Field Name: LASTCHANGEDATE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDATE
|
PPMRP_QUICKVIEW-LASTCHANGETIME table field -
▼
Description: Field Name: LASTCHANGETIME Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGETIME
|