SAP PINVTRYAVGSTV table - Generated Table for View details in SAP
Show table
SAP PINVTRYAVGSTV table summary Object Name: PINVTRYAVGSTV Dictionary Type: Table viewDescription: Generated Table for View
Field list for PINVTRYAVGSTV table on an S/4 SAP system
Details
PINVTRYAVGSTV-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
PINVTRYAVGSTV-MATERIAL table field - Material in Respect of Which Stock is Managed
▼
Description: Material in Respect of Which Stock is Managed Field Name: MATERIAL Data Element: MATBF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIAL
PINVTRYAVGSTV-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
PINVTRYAVGSTV-AVGMATLSTKQTYINMATLBASEUNIT table field -
▼
Description: Field Name: AVGMATLSTKQTYINMATLBASEUNIT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AVGMATLSTKQTYINMATLBASEUNIT
PINVTRYAVGSTV-AVERAGESTOCKVALUE table field -
▼
Description: Field Name: AVERAGESTOCKVALUE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AVERAGESTOCKVALUE
PINVTRYAVGSTV-MATPRICEUNITINCOCODECURRENCY table field -
▼
Description: Field Name: MATPRICEUNITINCOCODECURRENCY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATPRICEUNITINCOCODECURRENCY
PINVTRYAVGSTV-COMPANYCODECURRENCY table field -
▼
Description: Field Name: COMPANYCODECURRENCY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPANYCODECURRENCY
PINVTRYAVGSTV-COMPANYCODE table field -
▼
Description: Field Name: COMPANYCODE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPANYCODE
Search SAP tables