Details |
PCTRCANCQTY-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
PCTRCANCQTY-CONTRACTNUM table field - Trading Contract
▼
Description: Trading Contract Field Name: CONTRACTNUM Data Element: TKONN Data Type: length (Dec): 0(0) Check table: WBHK Conversion Routine: Domain Name: MemoryID: WKN AppClass: SHLP: WBHK SHLP Field: TKONN ConvExit: See all SAP tables containing field CONTRACTNUM
|
PCTRCANCQTY-TRADINGCONTRACTITEM table field - Item Number of Trading Contract
▼
Description: Item Number of Trading Contract Field Name: TRADINGCONTRACTITEM Data Element: TPOSN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WKP AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRADINGCONTRACTITEM
|
PCTRCANCQTY-ACMPRICINGASPECT table field - Pricing Aspect
▼
Description: Pricing Aspect Field Name: ACMPRICINGASPECT Data Element: WLF_PR_ASPECT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACMPRICINGASPECT
|
PCTRCANCQTY-ACMPRICINGASPECTVALUE table field - Pricing Aspect Counter
▼
Description: Pricing Aspect Counter Field Name: ACMPRICINGASPECTVALUE Data Element: WLF_PR_COUNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACMPRICINGASPECTVALUE
|
PCTRCANCQTY-TRADINGCONTRACTITEMQUANTITY table field -
▼
Description: Field Name: TRADINGCONTRACTITEMQUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRADINGCONTRACTITEMQUANTITY
|
PCTRCANCQTY-TRDGCONTRACTITEMUNITOFMEASURE table field - Purchase Order Unit of Measure
▼
Description: Purchase Order Unit of Measure Field Name: TRDGCONTRACTITEMUNITOFMEASURE Data Element: BSTME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRDGCONTRACTITEMUNITOFMEASURE
|
PCTRCANCQTY-CONTRACTMATERIAL table field - Material Number
▼
Description: Material Number Field Name: CONTRACTMATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field CONTRACTMATERIAL
|
PCTRCANCQTY-CONTRACTPLANT table field - Plant
▼
Description: Plant Field Name: CONTRACTPLANT Data Element: WERKS_D Data Type: length (Dec): 0(0) Check table: T001W Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field CONTRACTPLANT
|
PCTRCANCQTY-TRADINGCONTRACTTYPE table field - Trading Contract Type
▼
Description: Trading Contract Type Field Name: TRADINGCONTRACTTYPE Data Element: TCTYP Data Type: length (Dec): 0(0) Check table: TB2BE Conversion Routine: Domain Name: MemoryID: WKA AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRADINGCONTRACTTYPE
|
PCTRCANCQTY-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: length (Dec): 0(0) Check table: T001 Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
PCTRCANCQTY-STORAGELOCATION table field - Storage Location
▼
Description: Storage Location Field Name: STORAGELOCATION Data Element: LGORT_D Data Type: length (Dec): 0(0) Check table: T001L Conversion Routine: Domain Name: MemoryID: LAG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STORAGELOCATION
|
PCTRCANCQTY-DOCUMENTSIDE table field -
▼
Description: Field Name: DOCUMENTSIDE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTSIDE
|
PCTRCANCQTY-DOCUMENTDATE table field - Record Created On
▼
Description: Record Created On Field Name: DOCUMENTDATE Data Element: ERDAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTDATE
|
PCTRCANCQTY-TRADINGCONTRACTCREATEDBY table field - Name of Person Responsible for Creating the Object
▼
Description: Name of Person Responsible for Creating the Object Field Name: TRADINGCONTRACTCREATEDBY Data Element: ERNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRADINGCONTRACTCREATEDBY
|
PCTRCANCQTY-SALESORGANIZATION table field - Sales Organization
▼
Description: Sales Organization Field Name: SALESORGANIZATION Data Element: VKORG Data Type: length (Dec): 0(0) Check table: TVKO Conversion Routine: Domain Name: MemoryID: VKO AppClass: SHLP: C_VKORG SHLP Field: VKORG ConvExit: See all SAP tables containing field SALESORGANIZATION
|
PCTRCANCQTY-DISTRIBUTIONCHANNEL table field - Distribution Channel
▼
Description: Distribution Channel Field Name: DISTRIBUTIONCHANNEL Data Element: VTWEG Data Type: length (Dec): 0(0) Check table: TVKOV Conversion Routine: Domain Name: MemoryID: VTW AppClass: SHLP: C_VTWEG SHLP Field: VTWEG ConvExit: See all SAP tables containing field DISTRIBUTIONCHANNEL
|
PCTRCANCQTY-DIVISION table field - Division
▼
Description: Division Field Name: DIVISION Data Element: SPART Data Type: length (Dec): 0(0) Check table: TVTA Conversion Routine: Domain Name: MemoryID: SPA AppClass: SHLP: C_SPART SHLP Field: SPART ConvExit: See all SAP tables containing field DIVISION
|
PCTRCANCQTY-PURCHASINGORGANIZATION table field - Purchasing Organization
▼
Description: Purchasing Organization Field Name: PURCHASINGORGANIZATION Data Element: EKORG Data Type: length (Dec): 0(0) Check table: T024E Conversion Routine: Domain Name: MemoryID: EKO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGORGANIZATION
|
PCTRCANCQTY-PURCHASINGGROUP table field - Purchasing Group
▼
Description: Purchasing Group Field Name: PURCHASINGGROUP Data Element: EKGRP Data Type: length (Dec): 0(0) Check table: T024 Conversion Routine: Domain Name: MemoryID: EKG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGGROUP
|
PCTRCANCQTY-COMMODITY table field - Commodity
▼
Description: Commodity Field Name: COMMODITY Data Element: TBA_STOEFFCHEN Data Type: length (Dec): 0(0) Check table: TBAC_PHYSCOMM Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: TBAH_STOEFFCHEN SHLP Field: COMMODITY ConvExit: See all SAP tables containing field COMMODITY
|
PCTRCANCQTY-CUSTOMERNAME table field - Sold-to Party
▼
Description: Sold-to Party Field Name: CUSTOMERNAME Data Element: KUNAG Data Type: length (Dec): 0(0) Check table: KNA1 Conversion Routine: Domain Name: MemoryID: VAG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMERNAME
|
PCTRCANCQTY-SUPPLIERNAME table field - Supplier's Account Number
▼
Description: Supplier's Account Number Field Name: SUPPLIERNAME Data Element: ELIFN Data Type: length (Dec): 0(0) Check table: LFA1 Conversion Routine: Domain Name: MemoryID: LIF AppClass: SHLP: KRED_C SHLP Field: LIFNR ConvExit: See all SAP tables containing field SUPPLIERNAME
|
PCTRCANCQTY-PRICINGDOCUMENT table field - Number of the Document Condition
▼
Description: Number of the Document Condition Field Name: PRICINGDOCUMENT Data Element: KNUMV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRICINGDOCUMENT
|
PCTRCANCQTY-PRICINGPROCEDURE table field - Procedure (Pricing, Output Control, Acct. Det., Costing,...)
▼
Description: Procedure (Pricing, Output Control, Acct. Det., Costing,...) Field Name: PRICINGPROCEDURE Data Element: KALSM_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRICINGPROCEDURE
|
PCTRCANCQTY-TRDGCONTRPRCGASPECTSRCELOTID table field - Source Lot ID
▼
Description: Source Lot ID Field Name: TRDGCONTRPRCGASPECTSRCELOTID Data Element: /ACCGO/E_SOURCE_LOT_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRDGCONTRPRCGASPECTSRCELOTID
|
PCTRCANCQTY-ACMPRCGCNDNFLATPRICE table field - Total Amount
▼
Description: Total Amount Field Name: ACMPRCGCNDNFLATPRICE Data Element: /ACCGO/CPE_E_TOTAL_PRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACMPRCGCNDNFLATPRICE
|
PCTRCANCQTY-CONTRACTTRADEQUANTITY table field -
▼
Description: Field Name: CONTRACTTRADEQUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTRACTTRADEQUANTITY
|
PCTRCANCQTY-CONTRACTTRADEUNIT table field - Unit of Measure of Trade Quantity
▼
Description: Unit of Measure of Trade Quantity Field Name: CONTRACTTRADEUNIT Data Element: /ACCGO/E_CSL_TRADE_QTY_UOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTRACTTRADEUNIT
|
PCTRCANCQTY-PRICINGCONDITIONTERM table field - CPE Term - Number in Formula
▼
Description: CPE Term - Number in Formula Field Name: PRICINGCONDITIONTERM Data Element: CPET_TERMNO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRICINGCONDITIONTERM
|
PCTRCANCQTY-AGGREGATEDCANCELEDQTY table field -
▼
Description: Field Name: AGGREGATEDCANCELEDQTY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGGREGATEDCANCELEDQTY
|
PCTRCANCQTY-AGGREGATEDCANCELEDQTYUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: AGGREGATEDCANCELEDQTYUNIT Data Element: MEINS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGGREGATEDCANCELEDQTYUNIT
|