Details |
PCSHREQFLLW-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
PCSHREQFLLW-ORIGINSYSTEM table field - Logical system
▼
Description: Logical system Field Name: ORIGINSYSTEM Data Element: LOGSYS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: LOGSYS SHLP Field: LOGSYS ConvExit: See all SAP tables containing field ORIGINSYSTEM
|
PCSHREQFLLW-ORIGINAPPLICATION table field - Source Application
▼
Description: Source Application Field Name: ORIGINAPPLICATION Data Element: FQM_ORIGIN_APPLICATION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: FQM_ORIGIN_R_VH SHLP Field: ORIGIN_APPLICATION ConvExit: See all SAP tables containing field ORIGINAPPLICATION
|
PCSHREQFLLW-ORIGINDOCUMENT table field - Source Document ID
▼
Description: Source Document ID Field Name: ORIGINDOCUMENT Data Element: FQM_ORIGIN_DOC_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORIGINDOCUMENT
|
PCSHREQFLLW-ORIGINTRANSACTION table field - Source Transaction ID
▼
Description: Source Transaction ID Field Name: ORIGINTRANSACTION Data Element: FQM_ORIGIN_TRANS_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORIGINTRANSACTION
|
PCSHREQFLLW-ORIGINTRANSQUALIFIER table field - Source Transaction Qualifier
▼
Description: Source Transaction Qualifier Field Name: ORIGINTRANSQUALIFIER Data Element: FQM_ORIGIN_TRANS_QUALIFIER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORIGINTRANSQUALIFIER
|
PCSHREQFLLW-CASHFLOW table field - Line Item in Source Document
▼
Description: Line Item in Source Document Field Name: CASHFLOW Data Element: FQM_ORIGIN_FLOW_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CASHFLOW
|
PCSHREQFLLW-VALIDFROM table field - FQM Flow Valid From
▼
Description: FQM Flow Valid From Field Name: VALIDFROM Data Element: FQM_VALID_FROM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALIDFROM
|
PCSHREQFLLW-VALIDTO table field - FQM Flow Valid To
▼
Description: FQM Flow Valid To Field Name: VALIDTO Data Element: FQM_VALID_TO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALIDTO
|
PCSHREQFLLW-FLOW_ID table field - Flow ID
▼
Description: Flow ID Field Name: FLOW_ID Data Element: FQM_FLOW_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FLOW_ID
|
PCSHREQFLLW-ISVALID table field - FQM Flag Actual
▼
Description: FQM Flag Actual Field Name: ISVALID Data Element: FQM_FLG_ACTUAL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISVALID
|
PCSHREQFLLW-CREATEDBYUSER table field - FQM Flow Create User
▼
Description: FQM Flow Create User Field Name: CREATEDBYUSER Data Element: FQM_CREATE_USER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
PCSHREQFLLW-CREATIONDATETIME table field - FQM Flow Creation Timestamp
▼
Description: FQM Flow Creation Timestamp Field Name: CREATIONDATETIME Data Element: FQM_CREATE_TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATETIME
|
PCSHREQFLLW-LASTCHANGEDBYUSER table field - FQM Flow Last Update User
▼
Description: FQM Flow Last Update User Field Name: LASTCHANGEDBYUSER Data Element: FQM_UPDATE_USER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDBYUSER
|
PCSHREQFLLW-LASTCHANGEDATETIME table field - FQM Flow Update Timestamp
▼
Description: FQM Flow Update Timestamp Field Name: LASTCHANGEDATETIME Data Element: FQM_UPDATE_TIMESTAMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDATETIME
|
PCSHREQFLLW-OWNER table field - Owner of a Business Transaction
▼
Description: Owner of a Business Transaction Field Name: OWNER Data Element: FQM_OWNER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: FQMSH_OWNER SHLP Field: OWNER ConvExit: See all SAP tables containing field OWNER
|
PCSHREQFLLW-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
PCSHREQFLLW-TRANSACTIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: TRANSACTIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSACTIONDATE
|
PCSHREQFLLW-CERTAINTYLEVEL table field - Certainty Level
▼
Description: Certainty Level Field Name: CERTAINTYLEVEL Data Element: FQM_CERTAINTY_LEVEL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CERTAINTYLEVEL
|
PCSHREQFLLW-TRANSACTIONCURRENCY table field - Currency
▼
Description: Currency Field Name: TRANSACTIONCURRENCY Data Element: FQM_CURRENCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSACTIONCURRENCY
|
PCSHREQFLLW-AMOUNTINTRANSACTIONCURRENCY table field - Amount
▼
Description: Amount Field Name: AMOUNTINTRANSACTIONCURRENCY Data Element: FQM_AMOUNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINTRANSACTIONCURRENCY
|
PCSHREQFLLW-COMPANYCODECURRENCY table field - Currency
▼
Description: Currency Field Name: COMPANYCODECURRENCY Data Element: FQM_CURRENCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPANYCODECURRENCY
|
PCSHREQFLLW-AMOUNTINCOMPANYCODECURRENCY table field - Amount
▼
Description: Amount Field Name: AMOUNTINCOMPANYCODECURRENCY Data Element: FQM_AMOUNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINCOMPANYCODECURRENCY
|
PCSHREQFLLW-REL_STATUS table field - Release Status
▼
Description: Release Status Field Name: REL_STATUS Data Element: FQM_RELEASE_STATUS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REL_STATUS
|
PCSHREQFLLW-ACCOUNTINGDOCUMENT table field - Document Number of an Accounting Document
▼
Description: Document Number of an Accounting Document Field Name: ACCOUNTINGDOCUMENT Data Element: BELNR_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BLN AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTINGDOCUMENT
|
PCSHREQFLLW-ACCOUNTINGDOCUMENTITEM table field - Number of Line Item Within Accounting Document
▼
Description: Number of Line Item Within Accounting Document Field Name: ACCOUNTINGDOCUMENTITEM Data Element: BUZEI Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BUZ AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTINGDOCUMENTITEM
|
PCSHREQFLLW-FISCALYEAR table field - Fiscal Year
▼
Description: Fiscal Year Field Name: FISCALYEAR Data Element: GJAHR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: GJR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FISCALYEAR
|
PCSHREQFLLW-FISCALPERIOD table field - Fiscal Period
▼
Description: Fiscal Period Field Name: FISCALPERIOD Data Element: MONAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FISCALPERIOD
|
PCSHREQFLLW-ACCOUNTINGDOCUMENTTYPE table field - Document Type
▼
Description: Document Type Field Name: ACCOUNTINGDOCUMENTTYPE Data Element: BLART Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BAR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTINGDOCUMENTTYPE
|
PCSHREQFLLW-GLACCOUNT table field - General Ledger Account
▼
Description: General Ledger Account Field Name: GLACCOUNT Data Element: HKONT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GLACCOUNT
|
PCSHREQFLLW-FINANCIALACCOUNTTYPE table field - Account type
▼
Description: Account type Field Name: FINANCIALACCOUNTTYPE Data Element: KOART Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINANCIALACCOUNTTYPE
|
PCSHREQFLLW-CASHPLANNINGGROUP table field - Planning Group
▼
Description: Planning Group Field Name: CASHPLANNINGGROUP Data Element: FDGRP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: FFG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CASHPLANNINGGROUP
|
PCSHREQFLLW-PLANNINGLEVEL table field - Planning Level
▼
Description: Planning Level Field Name: PLANNINGLEVEL Data Element: FDLEV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: FFE AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANNINGLEVEL
|
PCSHREQFLLW-PAYMENTMETHOD table field - Payment Method
▼
Description: Payment Method Field Name: PAYMENTMETHOD Data Element: FQM_PAYMENT_METHOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENTMETHOD
|
PCSHREQFLLW-DOCUMENTITEMTEXT table field - Item Text
▼
Description: Item Text Field Name: DOCUMENTITEMTEXT Data Element: SGTXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTITEMTEXT
|
PCSHREQFLLW-POSTINGDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: POSTINGDATE Data Element: BUDAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field POSTINGDATE
|
PCSHREQFLLW-VALUEDATE table field - Value date
▼
Description: Value date Field Name: VALUEDATE Data Element: VALUT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALUEDATE
|
PCSHREQFLLW-HOUSEBANK table field - Short Key for a House Bank
▼
Description: Short Key for a House Bank Field Name: HOUSEBANK Data Element: HBKID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HOUSEBANK
|
PCSHREQFLLW-HOUSEBANKACCOUNT table field - ID for Account Details
▼
Description: ID for Account Details Field Name: HOUSEBANKACCOUNT Data Element: HKTID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HOUSEBANKACCOUNT
|
PCSHREQFLLW-BANKACCOUNTINTERNALID table field - Bank Account Technical ID
▼
Description: Bank Account Technical ID Field Name: BANKACCOUNTINTERNALID Data Element: FCLM_BAM_ACC_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BANKACCOUNTINTERNALID
|
PCSHREQFLLW-CUSTOMER table field - Customer Number
▼
Description: Customer Number Field Name: CUSTOMER Data Element: KUNNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: KUN AppClass: SHLP: C_KUNNR SHLP Field: KUNNR ConvExit: See all SAP tables containing field CUSTOMER
|
PCSHREQFLLW-VENDOR table field - Account Number of Supplier
▼
Description: Account Number of Supplier Field Name: VENDOR Data Element: LIFNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: LIF AppClass: SHLP: KRED_C SHLP Field: LIFNR ConvExit: See all SAP tables containing field VENDOR
|
PCSHREQFLLW-BUSINESSPARTNER table field - Business Partner Number
▼
Description: Business Partner Number Field Name: BUSINESSPARTNER Data Element: BU_PARTNER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BPA AppClass: SHLP: BUPA SHLP Field: PARTNER ConvExit: See all SAP tables containing field BUSINESSPARTNER
|
PCSHREQFLLW-PARTNERCOMPANY table field - Company ID of Trading Partner
▼
Description: Company ID of Trading Partner Field Name: PARTNERCOMPANY Data Element: RASSC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PGS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARTNERCOMPANY
|
PCSHREQFLLW-MATERIAL table field - Material Number
▼
Description: Material Number Field Name: MATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field MATERIAL
|
PCSHREQFLLW-BUSINESSAREA table field - Business Area
▼
Description: Business Area Field Name: BUSINESSAREA Data Element: GSBER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: GSB AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSAREA
|
PCSHREQFLLW-PROFITCENTER table field - Profit Center
▼
Description: Profit Center Field Name: PROFITCENTER Data Element: PRCTR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PRC AppClass: SHLP: PRCTR_EMPTY SHLP Field: PRCTR ConvExit: See all SAP tables containing field PROFITCENTER
|
PCSHREQFLLW-WBSELEMENTINTERNALID table field - Work Breakdown Structure Element (WBS Element)
▼
Description: Work Breakdown Structure Element (WBS Element) Field Name: WBSELEMENTINTERNALID Data Element: PS_PSP_PNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WBSELEMENTINTERNALID
|
PCSHREQFLLW-COSTCENTER table field - Cost Center
▼
Description: Cost Center Field Name: COSTCENTER Data Element: KOSTL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: KOS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COSTCENTER
|
PCSHREQFLLW-SEGMENT table field - Segment for Segmental Reporting
▼
Description: Segment for Segmental Reporting Field Name: SEGMENT Data Element: FB_SEGMENT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SEGMENT
|
PCSHREQFLLW-LIQUIDITYITEM table field - Liquidity Item
▼
Description: Liquidity Item Field Name: LIQUIDITYITEM Data Element: FLQPOS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: FLQPOS AppClass: SHLP: FLQLQPOS SHLP Field: LQPOS ConvExit: See all SAP tables containing field LIQUIDITYITEM
|
PCSHREQFLLW-SOURCECOMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: SOURCECOMPANYCODE Data Element: BUKRS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field SOURCECOMPANYCODE
|
PCSHREQFLLW-FUND table field - Fund
▼
Description: Fund Field Name: FUND Data Element: BP_GEBER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: FIC AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FUND
|
PCSHREQFLLW-GRANTID table field - Grant
▼
Description: Grant Field Name: GRANTID Data Element: GM_GRANT_NBR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: GM_GRANT_NBR AppClass: SHLP: GRANTS_GENERIC SHLP Field: GRANT_NUMBER ConvExit: See all SAP tables containing field GRANTID
|
PCSHREQFLLW-CONTRACTNUMBER table field - Contract Number
▼
Description: Contract Number Field Name: CONTRACTNUMBER Data Element: VERTNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTRACTNUMBER
|
PCSHREQFLLW-PRODUCTTYPE table field - Product Type
▼
Description: Product Type Field Name: PRODUCTTYPE Data Element: VVSART Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: SAN AppClass: SHLP: VVSART_APPL_BAS SHLP Field: GSART ConvExit: See all SAP tables containing field PRODUCTTYPE
|
PCSHREQFLLW-FINANCIALTRANSACTIONTYPE table field - Financial Transaction Type
▼
Description: Financial Transaction Type Field Name: FINANCIALTRANSACTIONTYPE Data Element: TB_SFHAART Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: T02 AppClass: SHLP: C_AT10 SHLP Field: SFHAART ConvExit: See all SAP tables containing field FINANCIALTRANSACTIONTYPE
|
PCSHREQFLLW-SECURITYCLASS table field - Security Class ID Number
▼
Description: Security Class ID Number Field Name: SECURITYCLASS Data Element: VVRANLW Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: RAN AppClass: SHLP: SECURITY_F4 SHLP Field: RANL ConvExit: See all SAP tables containing field SECURITYCLASS
|
PCSHREQFLLW-TRMSECURITYACCOUNT table field - Securities Account
▼
Description: Securities Account Field Name: TRMSECURITYACCOUNT Data Element: RLDEPO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: DEP AppClass: SHLP: ACC_CCD_CORE SHLP Field: RLDEPO ConvExit: See all SAP tables containing field TRMSECURITYACCOUNT
|
PCSHREQFLLW-PORTFOLIO table field - Portfolio
▼
Description: Portfolio Field Name: PORTFOLIO Data Element: RPORTB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: T50 AppClass: SHLP: H_RPORTB_CORE SHLP Field: RPORTB ConvExit: See all SAP tables containing field PORTFOLIO
|
PCSHREQFLLW-BANKSTATEMENTSHORTKEY table field - Internal Reference
▼
Description: Internal Reference Field Name: BANKSTATEMENTSHORTKEY Data Element: TB_REFER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BANKSTATEMENTSHORTKEY
|
PCSHREQFLLW-BANKSTATEMENTITEM table field - Memo Record Number (Line Item Number in Bank Statement)
▼
Description: Memo Record Number (Line Item Number in Bank Statement) Field Name: BANKSTATEMENTITEM Data Element: ESNUM_EB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BANKSTATEMENTITEM
|
PCSHREQFLLW-CMM_STATE table field - State for cash memo record
▼
Description: State for cash memo record Field Name: CMM_STATE Data Element: FQM_CMR_STATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMM_STATE
|
PCSHREQFLLW-CMM_STATISTICS_INDICATOR table field - Statistics Indicator
▼
Description: Statistics Indicator Field Name: CMM_STATISTICS_INDICATOR Data Element: STKNZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMM_STATISTICS_INDICATOR
|
PCSHREQFLLW-CASHREQUESTSTATUS table field - Cash Request Status
▼
Description: Cash Request Status Field Name: CASHREQUESTSTATUS Data Element: FQM_CASHREQ_STATUS Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FQM_CASHREQ_STATUS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CASHREQUESTSTATUS
|
PCSHREQFLLW-INSTRUMENTCATEGORY table field - Trade Request Instrument Category
▼
Description: Trade Request Instrument Category Field Name: INSTRUMENTCATEGORY Data Element: TPI_INSTRUMENT_CATEGORY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSTRUMENTCATEGORY
|
PCSHREQFLLW-BUYSELLINDICATOR table field - Buy/Sell Indicator
▼
Description: Buy/Sell Indicator Field Name: BUYSELLINDICATOR Data Element: TPI_FX_BUY_SELL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUYSELLINDICATOR
|
PCSHREQFLLW-CASHREQUESTASSIGNMENT table field - Assignment
▼
Description: Assignment Field Name: CASHREQUESTASSIGNMENT Data Element: TB_ZUOND Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CASHREQUESTASSIGNMENT
|
PCSHREQFLLW-CASHREQUESTCHARACTERISTICS table field - Characteristics
▼
Description: Characteristics Field Name: CASHREQUESTCHARACTERISTICS Data Element: TB_MERKM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CASHREQUESTCHARACTERISTICS
|
PCSHREQFLLW-CASHREQUESTINTERNALREFERENCE table field - Internal Reference
▼
Description: Internal Reference Field Name: CASHREQUESTINTERNALREFERENCE Data Element: TB_REFER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CASHREQUESTINTERNALREFERENCE
|