Details |
PCO1001TOTMINAMT-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
PCO1001TOTMINAMT-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: FIS_BUKRS Data Type: length (Dec): 0(0) Check table: T001 Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
PCO1001TOTMINAMT-FISCALYEAR table field - Fiscal Year
▼
Description: Fiscal Year Field Name: FISCALYEAR Data Element: FIS_GJAHR_NO_CONV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FISCALYEAR
|
PCO1001TOTMINAMT-STATRYRPTGENTITY table field - Reporting Entity
▼
Description: Reporting Entity Field Name: STATRYRPTGENTITY Data Element: SRF_REPORTING_ENTITY Data Type: length (Dec): 0(0) Check table: SRF_RPG_ENT Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SRF_RPG_ENT_SH SHLP Field: REPORTING_ENTITY ConvExit: See all SAP tables containing field STATRYRPTGENTITY
|
PCO1001TOTMINAMT-STATRYRPTCATEGORY table field - Report Category ID
▼
Description: Report Category ID Field Name: STATRYRPTCATEGORY Data Element: SRF_REP_CAT_ID Data Type: length (Dec): 0(0) Check table: SRF_REP_CAT Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SRF_REP_CAT_SH SHLP Field: REP_CAT_ID ConvExit: See all SAP tables containing field STATRYRPTCATEGORY
|
PCO1001TOTMINAMT-STATRYRPTRUNID table field - Report Run ID
▼
Description: Report Run ID Field Name: STATRYRPTRUNID Data Element: SRF_REPORT_RUN_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STATRYRPTRUNID
|
PCO1001TOTMINAMT-CO_DIANREPORTFORMAT table field - DIAN Report Format
▼
Description: DIAN Report Format Field Name: CO_DIANREPORTFORMAT Data Element: FICODIAN_REPORT_FORMAT Data Type: length (Dec): 0(0) Check table: FICODIANI_FORMAT Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CO_DIANREPORTFORMAT
|
PCO1001TOTMINAMT-CO_DIANREPORTITEMTYPE table field - Report Format Item Type
▼
Description: Report Format Item Type Field Name: CO_DIANREPORTITEMTYPE Data Element: FICODIAN_CONCEPT_CODE Data Type: length (Dec): 0(0) Check table: FICODIANC_CNCPT Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CO_DIANREPORTITEMTYPE
|
PCO1001TOTMINAMT-REPORTEDTAXNUMBER table field - Reporting Tax Number
▼
Description: Reporting Tax Number Field Name: REPORTEDTAXNUMBER Data Element: FICODIAN_TAX_NUMBER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REPORTEDTAXNUMBER
|
PCO1001TOTMINAMT-BUSINESSPLACE table field - Business Place
▼
Description: Business Place Field Name: BUSINESSPLACE Data Element: FARP_BUPLA Data Type: CHAR length (Dec): 4(0) Check table: PBUSINESSPLACE Conversion Routine: Domain Name: J_1BBRANCH MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSPLACE
|
PCO1001TOTMINAMT-CO_DIANTAXNUMBERTYPE table field - DIAN Type of Document
▼
Description: DIAN Type of Document Field Name: CO_DIANTAXNUMBERTYPE Data Element: FICODIAN_DOC_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CO_DIANTAXNUMBERTYPE
|
PCO1001TOTMINAMT-TAXNUMBERTYPE table field - Tax Number Type
▼
Description: Tax Number Type Field Name: TAXNUMBERTYPE Data Element: STCD_TYP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAXNUMBERTYPE
|
PCO1001TOTMINAMT-BUSINESSPARTNERCATEGORY table field - Business Partner Category
▼
Description: Business Partner Category Field Name: BUSINESSPARTNERCATEGORY Data Element: BU_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BPY AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSPARTNERCATEGORY
|
PCO1001TOTMINAMT-BUSINESSPARTNER table field - Business Partner Number
▼
Description: Business Partner Number Field Name: BUSINESSPARTNER Data Element: BU_PARTNER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BPA AppClass: SHLP: BUPA SHLP Field: PARTNER ConvExit: See all SAP tables containing field BUSINESSPARTNER
|
PCO1001TOTMINAMT-FIRSTNAME table field - First Name of Business Partner (Person)
▼
Description: First Name of Business Partner (Person) Field Name: FIRSTNAME Data Element: BU_NAMEP_F Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FIRSTNAME
|
PCO1001TOTMINAMT-MIDDLENAME table field - Middle name or second forename of a person
▼
Description: Middle name or second forename of a person Field Name: MIDDLENAME Data Element: BU_NAMEMID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MIDDLENAME
|
PCO1001TOTMINAMT-LASTNAME table field - Last Name of Business Partner (Person)
▼
Description: Last Name of Business Partner (Person) Field Name: LASTNAME Data Element: BU_NAMEP_L Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTNAME
|
PCO1001TOTMINAMT-ADDITIONALLASTNAME table field - Other Last Name of a Person
▼
Description: Other Last Name of a Person Field Name: ADDITIONALLASTNAME Data Element: BU_NAMEPL2 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADDITIONALLASTNAME
|
PCO1001TOTMINAMT-ORGANIZATIONBPNAME1 table field - Name 1 of organization
▼
Description: Name 1 of organization Field Name: ORGANIZATIONBPNAME1 Data Element: BU_NAMEOR1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORGANIZATIONBPNAME1
|
PCO1001TOTMINAMT-ORGANIZATIONBPNAME2 table field - Name 2 of organization
▼
Description: Name 2 of organization Field Name: ORGANIZATIONBPNAME2 Data Element: BU_NAMEOR2 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORGANIZATIONBPNAME2
|
PCO1001TOTMINAMT-ORGANIZATIONBPNAME3 table field - Name 3 of organization
▼
Description: Name 3 of organization Field Name: ORGANIZATIONBPNAME3 Data Element: BU_NAMEOR3 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORGANIZATIONBPNAME3
|
PCO1001TOTMINAMT-ORGANIZATIONBPNAME4 table field - Name 4 of organization
▼
Description: Name 4 of organization Field Name: ORGANIZATIONBPNAME4 Data Element: BU_NAMEOR4 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORGANIZATIONBPNAME4
|
PCO1001TOTMINAMT-ISNATURALPERSON table field - Natural Person
▼
Description: Natural Person Field Name: ISNATURALPERSON Data Element: STKZN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISNATURALPERSON
|
PCO1001TOTMINAMT-BUSINESSPARTNERCOUNTRY table field - Country/Region Key
▼
Description: Country/Region Key Field Name: BUSINESSPARTNERCOUNTRY Data Element: LAND1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: LND AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSPARTNERCOUNTRY
|
PCO1001TOTMINAMT-COMPANYCODECOUNTRY table field - Country/Region Key
▼
Description: Country/Region Key Field Name: COMPANYCODECOUNTRY Data Element: LAND1 Data Type: length (Dec): 0(0) Check table: T005 Conversion Routine: Domain Name: MemoryID: LND AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPANYCODECOUNTRY
|
PCO1001TOTMINAMT-CO_DIANCOUNTRY table field - DIAN Country/Region Code
▼
Description: DIAN Country/Region Code Field Name: CO_DIANCOUNTRY Data Element: FICODIAN_COUNTRY_CODE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CO_DIANCOUNTRY
|
PCO1001TOTMINAMT-REGION table field - Region (State, Province, County)
▼
Description: Region (State, Province, County) Field Name: REGION Data Element: REGIO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REGION
|
PCO1001TOTMINAMT-CITYCODE table field - City code for city/street file
▼
Description: City code for city/street file Field Name: CITYCODE Data Element: AD_CITYNUM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CITYCODE
|
PCO1001TOTMINAMT-CITYNAME table field - City
▼
Description: City Field Name: CITYNAME Data Element: AD_CITY1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: CLCITYNAME SHLP Field: CITY_NAME ConvExit: See all SAP tables containing field CITYNAME
|
PCO1001TOTMINAMT-STREETNAME table field - Street
▼
Description: Street Field Name: STREETNAME Data Element: AD_STREET Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: CLSTRTNAME SHLP Field: STREET ConvExit: See all SAP tables containing field STREETNAME
|
PCO1001TOTMINAMT-TAXNUMBER1 table field - Tax Number 1
▼
Description: Tax Number 1 Field Name: TAXNUMBER1 Data Element: STCD1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAXNUMBER1
|
PCO1001TOTMINAMT-TAXNUMBER2 table field - Tax Number 2
▼
Description: Tax Number 2 Field Name: TAXNUMBER2 Data Element: STCD2 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAXNUMBER2
|
PCO1001TOTMINAMT-TAXNUMBER3 table field - Tax Number 3
▼
Description: Tax Number 3 Field Name: TAXNUMBER3 Data Element: STCD3 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAXNUMBER3
|
PCO1001TOTMINAMT-TAXNUMBER4 table field - Tax Number 4
▼
Description: Tax Number 4 Field Name: TAXNUMBER4 Data Element: STCD4 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAXNUMBER4
|
PCO1001TOTMINAMT-TAXNUMBER5 table field - Tax Number 5
▼
Description: Tax Number 5 Field Name: TAXNUMBER5 Data Element: STCD5 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAXNUMBER5
|
PCO1001TOTMINAMT-VATREGISTRATION table field - VAT Registration Number
▼
Description: VAT Registration Number Field Name: VATREGISTRATION Data Element: STCEG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VATREGISTRATION
|
PCO1001TOTMINAMT-REPORTINGCURRENCY table field - Reporting Currency
▼
Description: Reporting Currency Field Name: REPORTINGCURRENCY Data Element: FICODIAN_REPORTING_CURRENCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REPORTINGCURRENCY
|
PCO1001TOTMINAMT-DCBLGLACCTPAYTSAMTINRPTGCRCY table field - Payments or Credits in deductible General Ledger Account
▼
Description: Payments or Credits in deductible General Ledger Account Field Name: DCBLGLACCTPAYTSAMTINRPTGCRCY Data Element: FICODIAN_PAYMCRED_DCBLGL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DCBLGLACCTPAYTSAMTINRPTGCRCY
|
PCO1001TOTMINAMT-NONDCBLGLACCTPAYTAMTINRPTGCRCY table field - Payments or Credits in Non Deductible General Ledger Account
▼
Description: Payments or Credits in Non Deductible General Ledger Account Field Name: NONDCBLGLACCTPAYTAMTINRPTGCRCY Data Element: FICODIAN_PAYMCRED_NONDCBLGL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NONDCBLGLACCTPAYTAMTINRPTGCRCY
|
PCO1001TOTMINAMT-DCBLVATINCRDCOSTINRPTGCRCY table field - Deductible VAT as increased amount of cost or expense
▼
Description: Deductible VAT as increased amount of cost or expense Field Name: DCBLVATINCRDCOSTINRPTGCRCY Data Element: FICODIAN_INCRDCOST_DCBLVAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DCBLVATINCRDCOSTINRPTGCRCY
|
PCO1001TOTMINAMT-NONDCBLVATINCRDCOSTINRPTGCRCY table field - Non Deductible VAT as increased amount of cost or expense
▼
Description: Non Deductible VAT as increased amount of cost or expense Field Name: NONDCBLVATINCRDCOSTINRPTGCRCY Data Element: FICODIAN_INCRDCOST_NONDCBLVAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NONDCBLVATINCRDCOSTINRPTGCRCY
|
PCO1001TOTMINAMT-WHLDGTXINCAMTINRPTGCURRENCY table field - Practiced Withholding on Income
▼
Description: Practiced Withholding on Income Field Name: WHLDGTXINCAMTINRPTGCURRENCY Data Element: FICODIAN_PRAC_WHLDG_INCOME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHLDGTXINCAMTINRPTGCURRENCY
|
PCO1001TOTMINAMT-TAKENWHLDGTAXINCAMTINRPTGCRCY table field - Withholding on Income Paid on Behalf Creditor
▼
Description: Withholding on Income Paid on Behalf Creditor Field Name: TAKENWHLDGTAXINCAMTINRPTGCRCY Data Element: FICODIAN_TAKEN_WHLDG_INCOME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAKENWHLDGTAXINCAMTINRPTGCRCY
|
PCO1001TOTMINAMT-WHLDGTAXCOMMONVATAMTINRPTGCRCY table field - Practiced Withholding on Common VAT
▼
Description: Practiced Withholding on Common VAT Field Name: WHLDGTAXCOMMONVATAMTINRPTGCRCY Data Element: FICODIAN_WHLDG_COMMON_VAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHLDGTAXCOMMONVATAMTINRPTGCRCY
|
PCO1001TOTMINAMT-TKNWHLDGSIMPFDVATAMTINRPTGCRCY table field - Paid Withholding on Simplified VAT on Behalf of Creditor
▼
Description: Paid Withholding on Simplified VAT on Behalf of Creditor Field Name: TKNWHLDGSIMPFDVATAMTINRPTGCRCY Data Element: FICODIAN_TKN_WHLDG_SPFD_VAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TKNWHLDGSIMPFDVATAMTINRPTGCRCY
|
PCO1001TOTMINAMT-WHLDGTXFOREIGNVATAMTINRPTGCRCY table field - Practiced Withholding on VAT for Foreigns
▼
Description: Practiced Withholding on VAT for Foreigns Field Name: WHLDGTXFOREIGNVATAMTINRPTGCRCY Data Element: FICODIAN_PRAC_WHT_FOREIGN_VAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WHLDGTXFOREIGNVATAMTINRPTGCRCY
|
PCO1001TOTMINAMT-CO_WHLDGCREEAMTINRPTGCURRENCY table field - Paid Withholding for CREE on behalf of Creditor
▼
Description: Paid Withholding for CREE on behalf of Creditor Field Name: CO_WHLDGCREEAMTINRPTGCURRENCY Data Element: FICODIAN_PRAC_WHT_CREE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CO_WHLDGCREEAMTINRPTGCURRENCY
|
PCO1001TOTMINAMT-CO_TKNWHLDGCREEAMTINRPTGCRCY table field - Practiced Withholding for CREE
▼
Description: Practiced Withholding for CREE Field Name: CO_TKNWHLDGCREEAMTINRPTGCRCY Data Element: FICODIAN_TKN_WHT_CREE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CO_TKNWHLDGCREEAMTINRPTGCRCY
|