Details |
PBRRPTGINVTRY-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
PBRRPTGINVTRY-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
PBRRPTGINVTRY-BUSINESSPLACE table field - Business Place
▼
Description: Business Place Field Name: BUSINESSPLACE Data Element: J_1BBRANC_ Data Type: CHAR length (Dec): 4(0) Check table: PBUSINESSPLACE Conversion Routine: Domain Name: J_1BBRANCH MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSPLACE
|
PBRRPTGINVTRY-MATERIAL table field - Material in Respect of Which Stock is Managed
▼
Description: Material in Respect of Which Stock is Managed Field Name: MATERIAL Data Element: MATBF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIAL
|
PBRRPTGINVTRY-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
|
PBRRPTGINVTRY-STORAGELOCATION table field - Storage Location
▼
Description: Storage Location Field Name: STORAGELOCATION Data Element: LGORT_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: LAG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STORAGELOCATION
|
PBRRPTGINVTRY-BATCH table field - Batch Number (Stock Identifier)
▼
Description: Batch Number (Stock Identifier) Field Name: BATCH Data Element: NSDM_CHARG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: CHA AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BATCH
|
PBRRPTGINVTRY-SUPPLIER table field - Supplier for Special Stock
▼
Description: Supplier for Special Stock Field Name: SUPPLIER Data Element: NSDM_LIFNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: LIF AppClass: SHLP: KRED_C SHLP Field: LIFNR ConvExit: See all SAP tables containing field SUPPLIER
|
PBRRPTGINVTRY-SDDOCUMENT table field - Sales order number of valuated sales order stock
▼
Description: Sales order number of valuated sales order stock Field Name: SDDOCUMENT Data Element: MAT_KDAUF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AUN AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SDDOCUMENT
|
PBRRPTGINVTRY-SDDOCUMENTITEM table field - Sales Order Item of Valuated Sales Order Stock
▼
Description: Sales Order Item of Valuated Sales Order Stock Field Name: SDDOCUMENTITEM Data Element: MAT_KDPOS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: KPO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SDDOCUMENTITEM
|
PBRRPTGINVTRY-WBSELEMENTINTERNALID table field - Valuated Sales Order Stock WBS Element
▼
Description: Valuated Sales Order Stock WBS Element Field Name: WBSELEMENTINTERNALID Data Element: MAT_PSPNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WBSELEMENTINTERNALID
|
PBRRPTGINVTRY-CUSTOMER table field - Customer for Special Stock
▼
Description: Customer for Special Stock Field Name: CUSTOMER Data Element: NSDM_KUNNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: KUN AppClass: SHLP: C_KUNNR SHLP Field: KUNNR ConvExit: See all SAP tables containing field CUSTOMER
|
PBRRPTGINVTRY-SPECIALSTOCKIDFGSTOCKOWNER table field - Add. Supplier for Special Stock
▼
Description: Add. Supplier for Special Stock Field Name: SPECIALSTOCKIDFGSTOCKOWNER Data Element: NSDM_DISUB_OWNER_SID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SPECIALSTOCKIDFGSTOCKOWNER
|
PBRRPTGINVTRY-INVENTORYSTOCKTYPE table field - Stock Type of Goods Movement (Stock Identifier)
▼
Description: Stock Type of Goods Movement (Stock Identifier) Field Name: INVENTORYSTOCKTYPE Data Element: NSDM_LBBSA Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INVENTORYSTOCKTYPE
|
PBRRPTGINVTRY-INVENTORYSPECIALSTOCKTYPE table field - Special Stock Type
▼
Description: Special Stock Type Field Name: INVENTORYSPECIALSTOCKTYPE Data Element: NSDM_SPCL_STOCK_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INVENTORYSPECIALSTOCKTYPE
|
PBRRPTGINVTRY-MATERIALBASEUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: MATERIALBASEUNIT Data Element: MEINS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALBASEUNIT
|
PBRRPTGINVTRY-COSTESTIMATE table field - Cost Estimate Number - Product Costing
▼
Description: Cost Estimate Number - Product Costing Field Name: COSTESTIMATE Data Element: CK_KALNR1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: KNE AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COSTESTIMATE
|
PBRRPTGINVTRY-INVENTORYPRICE table field -
▼
Description: Field Name: INVENTORYPRICE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INVENTORYPRICE
|
PBRRPTGINVTRY-MATERIALPRICEUNITQTY table field -
▼
Description: Field Name: MATERIALPRICEUNITQTY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALPRICEUNITQTY
|
PBRRPTGINVTRY-MATLWRHSSTKQTYINMATLBASEUNIT table field - Stock Quantity in Base Unit of Measure
▼
Description: Stock Quantity in Base Unit of Measure Field Name: MATLWRHSSTKQTYINMATLBASEUNIT Data Element: NSDM_MATERIAL_STOCK_IN_BUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATLWRHSSTKQTYINMATLBASEUNIT
|
PBRRPTGINVTRY-STOCKVALUEINCCCRCY table field - Stock Value in Company Code Currency
▼
Description: Stock Value in Company Code Currency Field Name: STOCKVALUEINCCCRCY Data Element: NSDM_STOCK_VALUE_IN_CCCRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKVALUEINCCCRCY
|
PBRRPTGINVTRY-CURRENCY table field - Currency Key
▼
Description: Currency Key Field Name: CURRENCY Data Element: WAERS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: FWS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CURRENCY
|
PBRRPTGINVTRY-CNSMPNLATESTPOSTGDATE table field - Date of Last Consumption Posting
▼
Description: Date of Last Consumption Posting Field Name: CNSMPNLATESTPOSTGDATE Data Element: NSDM_DATE_OF_LAST_CONSUMPTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSMPNLATESTPOSTGDATE
|
PBRRPTGINVTRY-MATLDOCLATESTPOSTGDATE table field - Date of Last Posting
▼
Description: Date of Last Posting Field Name: MATLDOCLATESTPOSTGDATE Data Element: NSDM_DATE_OF_LAST_POSTING Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATLDOCLATESTPOSTGDATE
|
PBRRPTGINVTRY-NUMBEROFDAYSSINCELASTCNSMPN table field - Number of Days Since Last Consumption Posting
▼
Description: Number of Days Since Last Consumption Posting Field Name: NUMBEROFDAYSSINCELASTCNSMPN Data Element: NSDM_NUMOFDAYSINCECONSUMPTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFDAYSSINCELASTCNSMPN
|
PBRRPTGINVTRY-NUMBEROFDAYSSINCELASTMOVEMENT table field - Number of Days Since Last Posting
▼
Description: Number of Days Since Last Posting Field Name: NUMBEROFDAYSSINCELASTMOVEMENT Data Element: NSDM_NUMOFDAYSINCEPOSTING Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFDAYSSINCELASTMOVEMENT
|
PBRRPTGINVTRY-MATERIALGROUP table field - Product Group
▼
Description: Product Group Field Name: MATERIALGROUP Data Element: PRODUCTGROUP Data Type: length (Dec): 0(0) Check table: T023 Conversion Routine: Domain Name: MemoryID: MKL AppClass: SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATERIALGROUP
|
PBRRPTGINVTRY-MATERIALGROUPNAME table field - Product Group Description
▼
Description: Product Group Description Field Name: MATERIALGROUPNAME Data Element: PRODUCTGROUPNAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALGROUPNAME
|
PBRRPTGINVTRY-MATERIALTYPE table field - Product Type
▼
Description: Product Type Field Name: MATERIALTYPE Data Element: PRODUCTTYPE Data Type: length (Dec): 0(0) Check table: T134 Conversion Routine: Domain Name: MemoryID: MTA AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALTYPE
|
PBRRPTGINVTRY-MATERIALTYPENAME table field - Description of product type
▼
Description: Description of product type Field Name: MATERIALTYPENAME Data Element: PRODUCTTYPENAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALTYPENAME
|
PBRRPTGINVTRY-MATERIALNAME table field - Product Description
▼
Description: Product Description Field Name: MATERIALNAME Data Element: PRODUCTDESCRIPTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALNAME
|
PBRRPTGINVTRY-PLANTNAME table field - Plant Name
▼
Description: Plant Name Field Name: PLANTNAME Data Element: WERKS_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANTNAME
|
PBRRPTGINVTRY-CHARTOFACCOUNTS table field - Chart of Accounts
▼
Description: Chart of Accounts Field Name: CHARTOFACCOUNTS Data Element: KTOPL Data Type: length (Dec): 0(0) Check table: T004 Conversion Routine: Domain Name: MemoryID: KPL AppClass: SHLP: C_KTOPL SHLP Field: KTOPL ConvExit: See all SAP tables containing field CHARTOFACCOUNTS
|
PBRRPTGINVTRY-VALUATIONAREA table field - Valuation Area
▼
Description: Valuation Area Field Name: VALUATIONAREA Data Element: BWKEY Data Type: length (Dec): 0(0) Check table: T001K Conversion Routine: Domain Name: MemoryID: BWK AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALUATIONAREA
|