SAP MPES_WI_EMB_VAR_PH_PARAM table - Variable and Place Holder Helper Structure details in SAP
SAP MPES_WI_EMB_VAR_PH_PARAM table summary
Object Name: MPES_WI_EMB_VAR_PH_PARAM Dictionary Type: Structure Description: Variable and Place Holder Helper Structure
Field list for MPES_WI_EMB_VAR_PH_PARAM table on an S/4 SAP system
Details
MPES_WI_EMB_VAR_PH_PARAM-SELECTEDCONTEXTNAME table field - Data Element for Attribute ▼
Description: Data Element for Attribute Field Name: SELECTEDCONTEXTNAME Data Element: MPE_ATTRIBUTE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit:
MPES_WI_EMB_VAR_PH_PARAM-MFGWRKINSTRNPLCHLDRINPTLBLTYPE table field - Label type for input place holder in work instructions ▼
Description: Label type for input place holder in work instructions Field Name: MFGWRKINSTRNPLCHLDRINPTLBLTYPE Data Element: MPE_WI_PH_IP_LABEL_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: