Details |
IWIPRRQHDITMDET-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
IWIPRRQHDITMDET-WORKFLOWTASKINTERNALID table field - Work item ID
▼
Description: Work item ID Field Name: WORKFLOWTASKINTERNALID Data Element: SWW_WIID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WID AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKFLOWTASKINTERNALID
|
IWIPRRQHDITMDET-PURCHASEREQUISITION table field - Purchase Requisition Number
▼
Description: Purchase Requisition Number Field Name: PURCHASEREQUISITION Data Element: BANFN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BAN AppClass: SHLP: MBAN_C SHLP Field: BANFN ConvExit: See all SAP tables containing field PURCHASEREQUISITION
|
IWIPRRQHDITMDET-PURCHASEREQUISITIONITEM table field - Item number of purchase requisition
▼
Description: Item number of purchase requisition Field Name: PURCHASEREQUISITIONITEM Data Element: VDM_PURCHASEREQUISITIONITEM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BAP AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQUISITIONITEM
|
IWIPRRQHDITMDET-PURREQNRELEASESTATUS table field - Requisition Processing State
▼
Description: Requisition Processing State Field Name: PURREQNRELEASESTATUS Data Element: BANPR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNRELEASESTATUS
|
IWIPRRQHDITMDET-PURCHASEREQUISITIONITEMTEXT table field - Short Text
▼
Description: Short Text Field Name: PURCHASEREQUISITIONITEMTEXT Data Element: TXZ01 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQUISITIONITEMTEXT
|
IWIPRRQHDITMDET-ACCOUNTASSIGNMENTCATEGORY table field - Account Assignment Category
▼
Description: Account Assignment Category Field Name: ACCOUNTASSIGNMENTCATEGORY Data Element: KNTTP Data Type: length (Dec): 0(0) Check table: T163K Conversion Routine: Domain Name: MemoryID: KNT AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTASSIGNMENTCATEGORY
|
IWIPRRQHDITMDET-MATERIAL table field - Material Number
▼
Description: Material Number Field Name: MATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field MATERIAL
|
IWIPRRQHDITMDET-REQUESTEDQUANTITY table field - Purchase requisition quantity
▼
Description: Purchase requisition quantity Field Name: REQUESTEDQUANTITY Data Element: BAMNG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQUESTEDQUANTITY
|
IWIPRRQHDITMDET-BASEUNIT table field - Purchase requisition unit of measure
▼
Description: Purchase requisition unit of measure Field Name: BASEUNIT Data Element: BAMEI Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASEUNIT
|
IWIPRRQHDITMDET-ITEMUOM table field - Purchase requisition unit of measure
▼
Description: Purchase requisition unit of measure Field Name: ITEMUOM Data Element: BAMEI Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ITEMUOM
|
IWIPRRQHDITMDET-PURCHASECONTRACT table field - Number of principal purchase agreement
▼
Description: Number of principal purchase agreement Field Name: PURCHASECONTRACT Data Element: KONNR Data Type: length (Dec): 0(0) Check table: EKKO Conversion Routine: Domain Name: MemoryID: KTR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASECONTRACT
|
IWIPRRQHDITMDET-PURCHASECONTRACTITEM table field - Item Number of Principal Purchase Agreement
▼
Description: Item Number of Principal Purchase Agreement Field Name: PURCHASECONTRACTITEM Data Element: KTPNR Data Type: length (Dec): 0(0) Check table: EKPO Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASECONTRACTITEM
|
IWIPRRQHDITMDET-PURCHASINGINFORECORD table field - Number of purchasing info record
▼
Description: Number of purchasing info record Field Name: PURCHASINGINFORECORD Data Element: INFNR Data Type: length (Dec): 0(0) Check table: EINA Conversion Routine: Domain Name: MemoryID: INF AppClass: SHLP: MEIN_C SHLP Field: INFNR ConvExit: See all SAP tables containing field PURCHASINGINFORECORD
|
IWIPRRQHDITMDET-PURCHASEREQUISITIONPRICE table field - Price in Purchase Requisition
▼
Description: Price in Purchase Requisition Field Name: PURCHASEREQUISITIONPRICE Data Element: BAPRE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQUISITIONPRICE
|
IWIPRRQHDITMDET-PURREQNPRICEQUANTITY table field - Price unit
▼
Description: Price unit Field Name: PURREQNPRICEQUANTITY Data Element: EPEIN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNPRICEQUANTITY
|
IWIPRRQHDITMDET-ITEMNETAMOUNT table field -
▼
Description: Field Name: ITEMNETAMOUNT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ITEMNETAMOUNT
|
IWIPRRQHDITMDET-PURREQNITEMCURRENCY table field - Currency Key
▼
Description: Currency Key Field Name: PURREQNITEMCURRENCY Data Element: WAERS Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: FWS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNITEMCURRENCY
|
IWIPRRQHDITMDET-MULTIPLEACCTASSGMTDISTRIBUTION table field - Distribution Indicator for Multiple Account Assignment
▼
Description: Distribution Indicator for Multiple Account Assignment Field Name: MULTIPLEACCTASSGMTDISTRIBUTION Data Element: VRTKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MULTIPLEACCTASSGMTDISTRIBUTION
|
IWIPRRQHDITMDET-PURCHASEREQUISITIONTYPE table field - Purchase Requisition Document Type
▼
Description: Purchase Requisition Document Type Field Name: PURCHASEREQUISITIONTYPE Data Element: BBSRT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BBA AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQUISITIONTYPE
|
IWIPRRQHDITMDET-CONSUMPTIONPOSTING table field - Consumption posting
▼
Description: Consumption posting Field Name: CONSUMPTIONPOSTING Data Element: KZVBR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONSUMPTIONPOSTING
|
IWIPRRQHDITMDET-PURCHASINGDOCUMENTITEMCATEGORY table field - Item category in purchasing document
▼
Description: Item category in purchasing document Field Name: PURCHASINGDOCUMENTITEMCATEGORY Data Element: PSTYP Data Type: length (Dec): 0(0) Check table: T163 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGDOCUMENTITEMCATEGORY
|
IWIPRRQHDITMDET-DELIVERYDATE table field - Item Delivery Date
▼
Description: Item Delivery Date Field Name: DELIVERYDATE Data Element: EINDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DELIVERYDATE
|
IWIPRRQHDITMDET-CREATEDBYUSER table field - Name of Person Responsible for Creating the Object
▼
Description: Name of Person Responsible for Creating the Object Field Name: CREATEDBYUSER Data Element: ERNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
IWIPRRQHDITMDET-MATERIALGROUP table field - Material Group
▼
Description: Material Group Field Name: MATERIALGROUP Data Element: MATKL Data Type: length (Dec): 0(0) Check table: T023 Conversion Routine: Domain Name: MemoryID: MKL AppClass: SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATERIALGROUP
|
IWIPRRQHDITMDET-PURCHASINGORGANIZATION table field - Purchasing Organization
▼
Description: Purchasing Organization Field Name: PURCHASINGORGANIZATION Data Element: EKORG Data Type: length (Dec): 0(0) Check table: T024E Conversion Routine: Domain Name: MemoryID: EKO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGORGANIZATION
|
IWIPRRQHDITMDET-PURCHASINGGROUP table field - Purchasing Group
▼
Description: Purchasing Group Field Name: PURCHASINGGROUP Data Element: EKGRP Data Type: length (Dec): 0(0) Check table: T024 Conversion Routine: Domain Name: MemoryID: EKG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGGROUP
|
IWIPRRQHDITMDET-PURCHASINGGROUPNAME table field - Purchasing Group Name
▼
Description: Purchasing Group Name Field Name: PURCHASINGGROUPNAME Data Element: MM_A_PURG_GRP_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGGROUPNAME
|
IWIPRRQHDITMDET-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: EWERK Data Type: length (Dec): 0(0) Check table: T001W Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANT
|
IWIPRRQHDITMDET-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: length (Dec): 0(0) Check table: T001 Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
IWIPRRQHDITMDET-SUPPLIER table field - Desired Vendor
▼
Description: Desired Vendor Field Name: SUPPLIER Data Element: WLIEF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLIER
|
IWIPRRQHDITMDET-SUPPLIERNAME table field - Name of Supplier
▼
Description: Name of Supplier Field Name: SUPPLIERNAME Data Element: MD_SUPPLIER_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLIERNAME
|
IWIPRRQHDITMDET-EXTPLANTFORPURG table field - Plant of External System
▼
Description: Plant of External System Field Name: EXTPLANTFORPURG Data Element: MM_PUR_HUB_WERKS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXTPLANTFORPURG
|
IWIPRRQHDITMDET-EXTMATERIALFORPURG table field - Material of External System
▼
Description: Material of External System Field Name: EXTMATERIALFORPURG Data Element: MM_PUR_HUB_MATNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXTMATERIALFORPURG
|
IWIPRRQHDITMDET-EXTPURGORGFORPURG table field - Purchasing Organization
▼
Description: Purchasing Organization Field Name: EXTPURGORGFORPURG Data Element: MM_PUR_HUB_EKORG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXTPURGORGFORPURG
|
IWIPRRQHDITMDET-EXTCOMPANYCODEFORPURG table field - Company Code of External System
▼
Description: Company Code of External System Field Name: EXTCOMPANYCODEFORPURG Data Element: MM_PUR_HUB_BUKRS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXTCOMPANYCODEFORPURG
|
IWIPRRQHDITMDET-ISDELETED table field - Deletion Indicator in Purchasing Document
▼
Description: Deletion Indicator in Purchasing Document Field Name: ISDELETED Data Element: ELOEK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISDELETED
|
IWIPRRQHDITMDET-PURREQNSSPCATALOG table field - Technical Key of a Web Service (for Example - a Catalog)
▼
Description: Technical Key of a Web Service (for Example - a Catalog) Field Name: PURREQNSSPCATALOG Data Element: BBP_WS_SERVICE_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNSSPCATALOG
|
IWIPRRQHDITMDET-FIXEDSUPPLIER table field - Fixed Supplier of External System
▼
Description: Fixed Supplier of External System Field Name: FIXEDSUPPLIER Data Element: MM_PUR_HUB_FLIEF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FIXEDSUPPLIER
|
IWIPRRQHDITMDET-CNSLDTNMATERIALTEXT table field - Material Number
▼
Description: Material Number Field Name: CNSLDTNMATERIALTEXT Data Element: MATNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field CNSLDTNMATERIALTEXT
|
IWIPRRQHDITMDET-SOURCEOFSUPPLY table field - Number of principal purchase agreement
▼
Description: Number of principal purchase agreement Field Name: SOURCEOFSUPPLY Data Element: KONNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: KTR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOURCEOFSUPPLY
|
IWIPRRQHDITMDET-PROCUREMENTHUBSOURCESYSTEM table field - Connected System ID
▼
Description: Connected System ID Field Name: PROCUREMENTHUBSOURCESYSTEM Data Element: MMPUR_D_SOURCE_SYS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: MMPUR_REQ_SH_BE_SYS SHLP Field: BE_SOURCE_SYS ConvExit: See all SAP tables containing field PROCUREMENTHUBSOURCESYSTEM
|
IWIPRRQHDITMDET-PURREQNSSPREQUESTOR table field - Requestor
▼
Description: Requestor Field Name: PURREQNSSPREQUESTOR Data Element: MMPUR_REQ_D_REQUESTOR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNSSPREQUESTOR
|
IWIPRRQHDITMDET-REQUISITIONERNAME table field - Name of requisitioner/requester
▼
Description: Name of requisitioner/requester Field Name: REQUISITIONERNAME Data Element: AFNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQUISITIONERNAME
|
IWIPRRQHDITMDET-STORAGELOCATION table field - Storage Location
▼
Description: Storage Location Field Name: STORAGELOCATION Data Element: LGORT_D Data Type: length (Dec): 0(0) Check table: T001L Conversion Routine: Domain Name: MemoryID: LAG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STORAGELOCATION
|
IWIPRRQHDITMDET-PRODUCTTYPECODE table field - Product Type Group
▼
Description: Product Type Group Field Name: PRODUCTTYPECODE Data Element: PRODUCT_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTTYPECODE
|
IWIPRRQHDITMDET-EXPECTEDOVERALLLIMITAMOUNT table field - Expected Value of Overall Limit
▼
Description: Expected Value of Overall Limit Field Name: EXPECTEDOVERALLLIMITAMOUNT Data Element: COMMITMENT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXPECTEDOVERALLLIMITAMOUNT
|
IWIPRRQHDITMDET-OVERALLLIMITAMOUNT table field - Overall Limit
▼
Description: Overall Limit Field Name: OVERALLLIMITAMOUNT Data Element: SUMLIMIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OVERALLLIMITAMOUNT
|
IWIPRRQHDITMDET-PURREQCREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: PURREQCREATIONDATE Data Element: BADAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQCREATIONDATE
|
IWIPRRQHDITMDET-PERFORMANCEPERIODSTARTDATE table field - Start Date for Period of Performance
▼
Description: Start Date for Period of Performance Field Name: PERFORMANCEPERIODSTARTDATE Data Element: MMPUR_SERVPROC_PERIOD_START Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERFORMANCEPERIODSTARTDATE
|
IWIPRRQHDITMDET-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance
▼
Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERFORMANCEPERIODENDDATE
|
IWIPRRQHDITMDET-PURCHASEREQUISITIONRELEASEDATE table field - Purchase Requisition Release Date
▼
Description: Purchase Requisition Release Date Field Name: PURCHASEREQUISITIONRELEASEDATE Data Element: FRGDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQUISITIONRELEASEDATE
|
IWIPRRQHDITMDET-PURCHASEREQNITEMUNIQUEID table field - Key to identify purchase requisition item
▼
Description: Key to identify purchase requisition item Field Name: PURCHASEREQNITEMUNIQUEID Data Element: MM_PUR_PR_ITEM_KEY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQNITEMUNIQUEID
|
IWIPRRQHDITMDET-TECHNICALWRKFLWOBJECTTYPE table field - Type of Objects in Persistent Object References
▼
Description: Type of Objects in Persistent Object References Field Name: TECHNICALWRKFLWOBJECTTYPE Data Element: SIBFTYPEID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TECHNICALWRKFLWOBJECTTYPE
|
IWIPRRQHDITMDET-TECHNICALWRKFLWOBJECT table field - Instance Ident. in BOR Compat. Persistent Object References
▼
Description: Instance Ident. in BOR Compat. Persistent Object References Field Name: TECHNICALWRKFLWOBJECT Data Element: SIBFBORIID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TECHNICALWRKFLWOBJECT
|
IWIPRRQHDITMDET-LASTCHANGEDATETIME table field -
▼
Description: Field Name: LASTCHANGEDATETIME Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDATETIME
|
IWIPRRQHDITMDET-WORKFLOWTASKRECIPIENT table field - Workflow: Recipient of Work Item
▼
Description: Workflow: Recipient of Work Item Field Name: WORKFLOWTASKRECIPIENT Data Element: SWW_RECIPIENT Data Type: length (Dec): 0(0) Check table: USR02 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKFLOWTASKRECIPIENT
|