Details |
ITRSYSVPV-MANDT table field -
▼
Description: Field Name: MANDT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
ITRSYSVPV-TRSYPOSSMLTDVALNPOSVALUUID table field - UUID of Flow of Simulated Valuation of Treasury Position
▼
Description: UUID of Flow of Simulated Valuation of Treasury Position Field Name: TRSYPOSSMLTDVALNPOSVALUUID Data Element: FTR_GEN_SIM_VAL_POS_VAL_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRSYPOSSMLTDVALNPOSVALUUID
|
ITRSYSVPV-TRSYPOSSMLTDVALUATIONUUID table field - UUID of Simulated Valuation of Treasury Position
▼
Description: UUID of Simulated Valuation of Treasury Position Field Name: TRSYPOSSMLTDVALUATIONUUID Data Element: FTR_GEN_SIM_VAL_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRSYPOSSMLTDVALUATIONUUID
|
ITRSYSVPV-TRSYSUBPOSITION table field - Subposition
▼
Description: Subposition Field Name: TRSYSUBPOSITION Data Element: FTR_GEN_SUBPOS_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRSYSUBPOSITION
|
ITRSYSVPV-TRSYLDGRPOSCOMP table field - Position Component
▼
Description: Position Component Field Name: TRSYLDGRPOSCOMP Data Element: TPM_POS_COMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRSYLDGRPOSCOMP
|
ITRSYSVPV-TRSYSMLTDPERENDCLSKEYFIGCAT table field - Category of Simulation Key Figures
▼
Description: Category of Simulation Key Figures Field Name: TRSYSMLTDPERENDCLSKEYFIGCAT Data Element: TSV_KEY_FIGURE_CATEGORY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRSYSMLTDPERENDCLSKEYFIGCAT
|
ITRSYSVPV-QUANTITYINPIECES table field - Quantity in Pieces
▼
Description: Quantity in Pieces Field Name: QUANTITYINPIECES Data Element: FTR_GEN_QUANTITY_IN_UNITS_L Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field QUANTITYINPIECES
|
ITRSYSVPV-NOMINALCURRENCY table field - Nominal Currency
▼
Description: Nominal Currency Field Name: NOMINALCURRENCY Data Element: FTR_GEN_NOMINAL_CURRENCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NOMINALCURRENCY
|
ITRSYSVPV-NOMINALAMOUNTINNOMINALCURRENCY table field - Nominal Amount
▼
Description: Nominal Amount Field Name: NOMINALAMOUNTINNOMINALCURRENCY Data Element: TPM_NOMINAL_AMT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NOMINALAMOUNTINNOMINALCURRENCY
|
ITRSYSVPV-ORIGLNOMINALAMTINNOMINALCRCY table field - Original Nominal Amount in Position Currency
▼
Description: Original Nominal Amount in Position Currency Field Name: ORIGLNOMINALAMTINNOMINALCRCY Data Element: TPM_NOMINAL_ORG_AMT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORIGLNOMINALAMTINNOMINALCRCY
|
ITRSYSVPV-POSITIONCURRENCY table field - Position Currency
▼
Description: Position Currency Field Name: POSITIONCURRENCY Data Element: FTR_GEN_POSITION_CRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field POSITIONCURRENCY
|
ITRSYSVPV-AMOUNTINPOSITIONCURRENCY table field - Amount in Position Currency
▼
Description: Amount in Position Currency Field Name: AMOUNTINPOSITIONCURRENCY Data Element: FTR_GEN_AMOUNT_POSITION_CRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINPOSITIONCURRENCY
|
ITRSYSVPV-INDEXCLEANAMOUNTINPOSITIONCRCY table field - Index Clean Amount in Position Currency
▼
Description: Index Clean Amount in Position Currency Field Name: INDEXCLEANAMOUNTINPOSITIONCRCY Data Element: FTR_GEN_IDXCLN_AMNT_PSTN_CRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INDEXCLEANAMOUNTINPOSITIONCRCY
|
ITRSYSVPV-VALUATIONCURRENCY table field - Valuation Currency
▼
Description: Valuation Currency Field Name: VALUATIONCURRENCY Data Element: FTR_GEN_VALUATION_CURRENCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALUATIONCURRENCY
|
ITRSYSVPV-AMOUNTINVALUATIONCURRENCY table field - Amount in Valuation Currency
▼
Description: Amount in Valuation Currency Field Name: AMOUNTINVALUATIONCURRENCY Data Element: FTR_GEN_AMOUNT_VALUATION_CRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINVALUATIONCURRENCY
|