Details |
ITRSYMRKFVALC-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
ITRSYMRKFVALC-VALIDITYDATE table field - Key Date in Results Databases
▼
Description: Key Date in Results Databases Field Name: VALIDITYDATE Data Element: RDB_KEYDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALIDITYDATE
|
ITRSYMRKFVALC-MARKETRISKKEYFIGURESET table field - Market Risk Key Figure Set
▼
Description: Market Risk Key Figure Set Field Name: MARKETRISKKEYFIGURESET Data Element: AFWGO_MRA_KF_SET Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MARKETRISKKEYFIGURESET
|
ITRSYMRKFVALC-TREASURYFINANCIALOBJECT table field - Object Number for Financial Transactions
▼
Description: Object Number for Financial Transactions Field Name: TREASURYFINANCIALOBJECT Data Element: JBOBJNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TREASURYFINANCIALOBJECT
|
ITRSYMRKFVALC-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: length (Dec): 0(0) Check table: T001 Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
ITRSYMRKFVALC-TREASURYCONTRACTTYPE table field - Contract Type
▼
Description: Contract Type Field Name: TREASURYCONTRACTTYPE Data Element: RANTYP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TREASURYCONTRACTTYPE
|
ITRSYMRKFVALC-FINANCIALINSTRPRODUCTCATEGORY table field - Product Category
▼
Description: Product Category Field Name: FINANCIALINSTRPRODUCTCATEGORY Data Element: SANLF Data Type: length (Dec): 0(0) Check table: TZAF Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINANCIALINSTRPRODUCTCATEGORY
|
ITRSYMRKFVALC-FINANCIALINSTRUMENTPRODUCTTYPE table field - Product Type
▼
Description: Product Type Field Name: FINANCIALINSTRUMENTPRODUCTTYPE Data Element: VVSART Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: SAN AppClass: SHLP: VVSART_APPL_BAS SHLP Field: GSART ConvExit: See all SAP tables containing field FINANCIALINSTRUMENTPRODUCTTYPE
|
ITRSYMRKFVALC-PORTFOLIO table field - Portfolio
▼
Description: Portfolio Field Name: PORTFOLIO Data Element: RPORTB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: T50 AppClass: SHLP: H_RPORTB_CORE SHLP Field: RPORTB ConvExit: See all SAP tables containing field PORTFOLIO
|
ITRSYMRKFVALC-FINANCIALTRANSACTION table field - Financial Transaction
▼
Description: Financial Transaction Field Name: FINANCIALTRANSACTION Data Element: TB_RFHA Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: FAN AppClass: SHLP: VTBA SHLP Field: RFHA ConvExit: See all SAP tables containing field FINANCIALTRANSACTION
|
ITRSYMRKFVALC-SECURITYCLASS table field - Security Class ID Number
▼
Description: Security Class ID Number Field Name: SECURITYCLASS Data Element: VVRANLW Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: RAN AppClass: SHLP: SECURITY_F4 SHLP Field: RANL ConvExit: See all SAP tables containing field SECURITYCLASS
|
ITRSYMRKFVALC-SECURITYACCOUNT table field - Securities Account
▼
Description: Securities Account Field Name: SECURITYACCOUNT Data Element: VRLDEPO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: DEP AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SECURITYACCOUNT
|
ITRSYMRKFVALC-TREASURYPOSITIONACCOUNT table field - Futures Account for Listed Options and Futures
▼
Description: Futures Account for Listed Options and Futures Field Name: TREASURYPOSITIONACCOUNT Data Element: TPM_POS_ACCOUNT_FUT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: TRF_PAC AppClass: SHLP: TRFC_F4_POS_ACCOUNT SHLP Field: POS_ACCOUNT ConvExit: See all SAP tables containing field TREASURYPOSITIONACCOUNT
|
ITRSYMRKFVALC-FINANCIALEXPOSUREPOSITION table field - Exposure Position ID
▼
Description: Exposure Position ID Field Name: FINANCIALEXPOSUREPOSITION Data Element: FTR_POSITION_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: TEXH_POSITION SHLP Field: POSITION_ID ConvExit: See all SAP tables containing field FINANCIALEXPOSUREPOSITION
|
ITRSYMRKFVALC-LOANCONTRACT table field - Contract Number
▼
Description: Contract Number Field Name: LOANCONTRACT Data Element: RANL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: RAN AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LOANCONTRACT
|
ITRSYMRKFVALC-BUSINESSPARTNER table field - Business Partner Number
▼
Description: Business Partner Number Field Name: BUSINESSPARTNER Data Element: BU_PARTNER Data Type: length (Dec): 0(0) Check table: BUT000 Conversion Routine: Domain Name: MemoryID: BPA AppClass: SHLP: BUPA SHLP Field: PARTNER ConvExit: See all SAP tables containing field BUSINESSPARTNER
|
ITRSYMRKFVALC-MKTRISKCHARACTERISTICCURRENCY table field - Analytic Characteristic Currency
▼
Description: Analytic Characteristic Currency Field Name: MKTRISKCHARACTERISTICCURRENCY Data Element: FTB_CHAR_CURRENCY Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MKTRISKCHARACTERISTICCURRENCY
|
ITRSYMRKFVALC-COUNTRY table field - Country/Region Key
▼
Description: Country/Region Key Field Name: COUNTRY Data Element: LAND1 Data Type: length (Dec): 0(0) Check table: T005 Conversion Routine: Domain Name: MemoryID: LND AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COUNTRY
|
ITRSYMRKFVALC-FINANCIALINSTRCHARACTERISTIC table field - Characteristics
▼
Description: Characteristics Field Name: FINANCIALINSTRCHARACTERISTIC Data Element: TB_MERKM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINANCIALINSTRCHARACTERISTIC
|
ITRSYMRKFVALC-NETPRESENTVALUESIGN table field - Sign of Net Present Value
▼
Description: Sign of Net Present Value Field Name: NETPRESENTVALUESIGN Data Element: RDBRA_NPV_SIGN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NETPRESENTVALUESIGN
|
ITRSYMRKFVALC-NETPRESENTVALUEINEVALCRCY table field - Net Present Value in Evaluation Currency
▼
Description: Net Present Value in Evaluation Currency Field Name: NETPRESENTVALUEINEVALCRCY Data Element: FTR_MRA_NPV_IN_EVALCRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NETPRESENTVALUEINEVALCRCY
|
ITRSYMRKFVALC-NETPRESENTVALUEINDISPLAYCRCY table field - Net Present Value in Display Currency
▼
Description: Net Present Value in Display Currency Field Name: NETPRESENTVALUEINDISPLAYCRCY Data Element: FTR_MRA_NPV_IN_DSPCRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NETPRESENTVALUEINDISPLAYCRCY
|
ITRSYMRKFVALC-NETPRESENTVALUE table field - Net Present Value
▼
Description: Net Present Value Field Name: NETPRESENTVALUE Data Element: RDBRA_NPV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NETPRESENTVALUE
|
ITRSYMRKFVALC-DURATIONNETPRESENTVALUE table field - Net Present Value Used for Duration Calculation
▼
Description: Net Present Value Used for Duration Calculation Field Name: DURATIONNETPRESENTVALUE Data Element: RDBRA_DURATION_NPV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DURATIONNETPRESENTVALUE
|
ITRSYMRKFVALC-CLEANPRICEAMOUNTINEVALCRCY table field - Clean Price in Evaluation Currency
▼
Description: Clean Price in Evaluation Currency Field Name: CLEANPRICEAMOUNTINEVALCRCY Data Element: FTR_MRA_CLEANPRICE_IN_EVALCRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CLEANPRICEAMOUNTINEVALCRCY
|
ITRSYMRKFVALC-CLEANPRICEAMOUNTINDISPLAYCRCY table field - Clean Price in Display Currency
▼
Description: Clean Price in Display Currency Field Name: CLEANPRICEAMOUNTINDISPLAYCRCY Data Element: FTR_MRA_CLEANPRICE_IN_DSPCRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CLEANPRICEAMOUNTINDISPLAYCRCY
|
ITRSYMRKFVALC-NGTVINTRATESHIFTNETPRESENTVAL table field - Net Present Value of Symmetric Negative Interest Rate Shift
▼
Description: Net Present Value of Symmetric Negative Interest Rate Shift Field Name: NGTVINTRATESHIFTNETPRESENTVAL Data Element: RDBRA_NEG_INT_SHIFT_NPV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NGTVINTRATESHIFTNETPRESENTVAL
|
ITRSYMRKFVALC-PSTVINTRATESHIFTNETPRESENTVAL table field - Net Present Value of Symmetric Positive Interest Rate Shift
▼
Description: Net Present Value of Symmetric Positive Interest Rate Shift Field Name: PSTVINTRATESHIFTNETPRESENTVAL Data Element: RDBRA_POS_INT_SHIFT_NPV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PSTVINTRATESHIFTNETPRESENTVAL
|
ITRSYMRKFVALC-BASEPOINTVALUEAMOUNTINEVALCRCY table field - Basis Point Value in Evaluation Currency
▼
Description: Basis Point Value in Evaluation Currency Field Name: BASEPOINTVALUEAMOUNTINEVALCRCY Data Element: FTR_MRA_BASEPOINTVALUE_IN_EC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASEPOINTVALUEAMOUNTINEVALCRCY
|
ITRSYMRKFVALC-BASEPOINTVALUEAMOUNTINDSPCRCY table field - Basis Point Value in Display Currency
▼
Description: Basis Point Value in Display Currency Field Name: BASEPOINTVALUEAMOUNTINDSPCRCY Data Element: FTR_MRA_BASEPOINTVALUE_IN_DC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASEPOINTVALUEAMOUNTINDSPCRCY
|
ITRSYMRKFVALC-MACAULAYDURNWGTDNETPRESENTVAL table field -
▼
Description: Field Name: MACAULAYDURNWGTDNETPRESENTVAL Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MACAULAYDURNWGTDNETPRESENTVAL
|
ITRSYMRKFVALC-MODIFIEDDURNWGTDNETPRESENTVAL table field -
▼
Description: Field Name: MODIFIEDDURNWGTDNETPRESENTVAL Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MODIFIEDDURNWGTDNETPRESENTVAL
|
ITRSYMRKFVALC-OPTIONDELTAVALUE table field - Option Delta
▼
Description: Option Delta Field Name: OPTIONDELTAVALUE Data Element: RDBRA_OPTION_DELTA Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OPTIONDELTAVALUE
|
ITRSYMRKFVALC-YIELDTOMATURITYRATE table field - Yield to Maturity
▼
Description: Yield to Maturity Field Name: YIELDTOMATURITYRATE Data Element: RDBRA_YIELDTOMATURITY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field YIELDTOMATURITYRATE
|
ITRSYMRKFVALC-NUMBEROFRECORDS table field -
▼
Description: Field Name: NUMBEROFRECORDS Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFRECORDS
|
ITRSYMRKFVALC-EVALUATIONCURRENCY table field - Evaluation Currency
▼
Description: Evaluation Currency Field Name: EVALUATIONCURRENCY Data Element: AFW_EVAL_CURRENCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EVALUATIONCURRENCY
|
ITRSYMRKFVALC-DISPLAYCURRENCY table field - Display Currency
▼
Description: Display Currency Field Name: DISPLAYCURRENCY Data Element: VDM_V_DISPLAY_CURRENCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DISPLAYCURRENCY
|