Details |
ITRANSPLANEMTP-MANDT table field - Client (APO Conversion to Client-Dependency)
▼
Description: Client (APO Conversion to Client-Dependency) Field Name: MANDT Data Element: /SAPAPO/CLNTAPO_MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
ITRANSPLANEMTP-INTERNALTRANSPMETHODUUID table field - Internal no. of a transportation method (product-dependent)
▼
Description: Internal no. of a transportation method (product-dependent) Field Name: INTERNALTRANSPMETHODUUID Data Element: /SAPAPO/TR_TRPMID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INTERNALTRANSPMETHODUUID
|
ITRANSPLANEMTP-SCMSOURCEOFSUPPLYUUID table field - Internal Number of Source of Supply
▼
Description: Internal Number of Source of Supply Field Name: SCMSOURCEOFSUPPLYUUID Data Element: /SAPAPO/TR_TRPID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SCMSOURCEOFSUPPLYUUID
|
ITRANSPLANEMTP-TRANSPMETHODUUID table field - ID of Transportation Method of a Transportation Lane
▼
Description: ID of Transportation Method of a Transportation Lane Field Name: TRANSPMETHODUUID Data Element: /SAPAPO/TR_TRMID Data Type: length (Dec): 0(0) Check table: /SAPAPO/TRM Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSPMETHODUUID
|
ITRANSPLANEMTP-MEANSOFTRANSPORTVEHICLE table field - Means of Transport
▼
Description: Means of Transport Field Name: MEANSOFTRANSPORTVEHICLE Data Element: /SAPAPO/TR_TRATY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: /SAPAPO/TTYPE AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MEANSOFTRANSPORTVEHICLE
|
ITRANSPLANEMTP-STARTLOCATIONVALDTYSTRTDTETME table field - Time Stamp at Start of Validity Period
▼
Description: Time Stamp at Start of Validity Period Field Name: STARTLOCATIONVALDTYSTRTDTETME Data Element: /SAPAPO/SCC_VALFROMTSTMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STARTLOCATIONVALDTYSTRTDTETME
|
ITRANSPLANEMTP-STARTLOCATIONVALDTYENDDTETME table field - Time Stamp at End of Validity Period
▼
Description: Time Stamp at End of Validity Period Field Name: STARTLOCATIONVALDTYENDDTETME Data Element: /SAPAPO/SCC_VALTOTSTMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STARTLOCATIONVALDTYENDDTETME
|
ITRANSPLANEMTP-TRANSPPRODUCTISNOTALLOWED table field - Specifies Whether MTr Is Not Allowed for Product
▼
Description: Specifies Whether MTr Is Not Allowed for Product Field Name: TRANSPPRODUCTISNOTALLOWED Data Element: /SAPAPO/TR_NOTALLOWFLG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSPPRODUCTISNOTALLOWED
|
ITRANSPLANEMTP-VARIABLETRANSPORTATIONCOSTSVAL table field - Variable Transportation Costs
▼
Description: Variable Transportation Costs Field Name: VARIABLETRANSPORTATIONCOSTSVAL Data Element: /SAPAPO/TR_TRCOST Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VARIABLETRANSPORTATIONCOSTSVAL
|
ITRANSPLANEMTP-COSTFUNCTIONUUID table field - Supply Network Planning: Internal number for cost function
▼
Description: Supply Network Planning: Internal number for cost function Field Name: COSTFUNCTIONUUID Data Element: /SAPAPO/SNPCOSID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COSTFUNCTIONUUID
|
ITRANSPLANEMTP-TRANSPCAPACITYCNSMPNQTYVAL table field -
▼
Description: Field Name: TRANSPCAPACITYCNSMPNQTYVAL Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSPCAPACITYCNSMPNQTYVAL
|
ITRANSPLANEMTP-TRANSPCAPACITYUOM table field - Unit for Consumption of Transportation Capacity
▼
Description: Unit for Consumption of Transportation Capacity Field Name: TRANSPCAPACITYUOM Data Element: /SAPAPO/TR_CONSUNIT Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSPCAPACITYUOM
|
ITRANSPLANEMTP-TRANSPLANELOTSIZEUUID table field - Internal Number for Lot Size Profile of Transportation Lanes
▼
Description: Internal Number for Lot Size Profile of Transportation Lanes Field Name: TRANSPLANELOTSIZEUUID Data Element: VDM_SAPAPO_TSZID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSPLANELOTSIZEUUID
|
ITRANSPLANEMTP-SCMSTACKINGFACTOR table field - Stacking Factor
▼
Description: Stacking Factor Field Name: SCMSTACKINGFACTOR Data Element: /SAPAPO/STFAC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SCMSTACKINGFACTOR
|