Details |
ISU_TSCALCCRTREQITMPERINCLD-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
ISU_TSCALCCRTREQITMPERINCLD-DATE_TIME_PERIOD table field -
▼
Description: Field Name: DATE_TIME_PERIOD Data Element: ISU_CLSDLOCAL_DATE_TIME_PERIOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DATE_TIME_PERIOD
|
ISU_TSCALCCRTREQITMPERINCLD-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
ISU_TSCALCCRTREQITMPERINCLD-START_DATE_TIME table field -
▼
Description: Field Name: START_DATE_TIME Data Element: ISU_LOCAL_DATE_TIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field START_DATE_TIME
|
ISU_TSCALCCRTREQITMPERINCLD-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
ISU_TSCALCCRTREQITMPERINCLD-TIME_ZONE_CODE table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: TIME_ZONE_CODE Data Element: ISU_TIMEZONECODE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TIME_ZONE_CODE
|
ISU_TSCALCCRTREQITMPERINCLD-DAYLIGHT_SAVING_TIME_INDICATOR table field - XSD Truth Value: True/False [ext.]
▼
Description: XSD Truth Value: True/False [ext.] Field Name: DAYLIGHT_SAVING_TIME_INDICATOR Data Element: XSDBOOLEAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DAYLIGHT_SAVING_TIME_INDICATOR
|
ISU_TSCALCCRTREQITMPERINCLD-CONTENT table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: CONTENT Data Element: ISU_LOCAL_DATE_TIME_CONTENT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTENT
|
ISU_TSCALCCRTREQITMPERINCLD-END_DATE_TIME table field -
▼
Description: Field Name: END_DATE_TIME Data Element: ISU_LOCAL_DATE_TIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field END_DATE_TIME
|
ISU_TSCALCCRTREQITMPERINCLD-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
ISU_TSCALCCRTREQITMPERINCLD-TIME_ZONE_CODE table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: TIME_ZONE_CODE Data Element: ISU_TIMEZONECODE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TIME_ZONE_CODE
|
ISU_TSCALCCRTREQITMPERINCLD-DAYLIGHT_SAVING_TIME_INDICATOR table field - XSD Truth Value: True/False [ext.]
▼
Description: XSD Truth Value: True/False [ext.] Field Name: DAYLIGHT_SAVING_TIME_INDICATOR Data Element: XSDBOOLEAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DAYLIGHT_SAVING_TIME_INDICATOR
|
ISU_TSCALCCRTREQITMPERINCLD-CONTENT table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: CONTENT Data Element: ISU_LOCAL_DATE_TIME_CONTENT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTENT
|
ISU_TSCALCCRTREQITMPERINCLD-WEEKDAY_SELECTION table field -
▼
Description: Field Name: WEEKDAY_SELECTION Data Element: ISU_WEEKDAY_SELECTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WEEKDAY_SELECTION
|
ISU_TSCALCCRTREQITMPERINCLD-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
ISU_TSCALCCRTREQITMPERINCLD-MONDAY_INDICATOR table field - Indicator is the representation of a situation that has exac
▼
Description: Indicator is the representation of a situation that has exac Field Name: MONDAY_INDICATOR Data Element: ISU_INDICATOR1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MONDAY_INDICATOR
|
ISU_TSCALCCRTREQITMPERINCLD-TUESDAY_INDICATOR table field - Indicator is the representation of a situation that has exac
▼
Description: Indicator is the representation of a situation that has exac Field Name: TUESDAY_INDICATOR Data Element: ISU_INDICATOR1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TUESDAY_INDICATOR
|
ISU_TSCALCCRTREQITMPERINCLD-WEDNESDAY_INDICATOR table field - Indicator is the representation of a situation that has exac
▼
Description: Indicator is the representation of a situation that has exac Field Name: WEDNESDAY_INDICATOR Data Element: ISU_INDICATOR1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WEDNESDAY_INDICATOR
|
ISU_TSCALCCRTREQITMPERINCLD-THURSDAY_INDICATOR table field - Indicator is the representation of a situation that has exac
▼
Description: Indicator is the representation of a situation that has exac Field Name: THURSDAY_INDICATOR Data Element: ISU_INDICATOR1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field THURSDAY_INDICATOR
|
ISU_TSCALCCRTREQITMPERINCLD-FRIDAY_INDICATOR table field - Indicator is the representation of a situation that has exac
▼
Description: Indicator is the representation of a situation that has exac Field Name: FRIDAY_INDICATOR Data Element: ISU_INDICATOR1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FRIDAY_INDICATOR
|
ISU_TSCALCCRTREQITMPERINCLD-SATURDAY_INDICATOR table field - Indicator is the representation of a situation that has exac
▼
Description: Indicator is the representation of a situation that has exac Field Name: SATURDAY_INDICATOR Data Element: ISU_INDICATOR1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SATURDAY_INDICATOR
|
ISU_TSCALCCRTREQITMPERINCLD-SUNDAY_INDICATOR table field - Indicator is the representation of a situation that has exac
▼
Description: Indicator is the representation of a situation that has exac Field Name: SUNDAY_INDICATOR Data Element: ISU_INDICATOR1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUNDAY_INDICATOR
|
ISU_TSCALCCRTREQITMPERINCLD-AGGREGATION_TIME_PERIOD table field -
▼
Description: Field Name: AGGREGATION_TIME_PERIOD Data Element: ISU_TIME_PERIOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGGREGATION_TIME_PERIOD
|
ISU_TSCALCCRTREQITMPERINCLD-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
ISU_TSCALCCRTREQITMPERINCLD-START_TIME table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: START_TIME Data Element: ISU_TIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field START_TIME
|
ISU_TSCALCCRTREQITMPERINCLD-END_TIME table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: END_TIME Data Element: ISU_TIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field END_TIME
|
ISU_TSCALCCRTREQITMPERINCLD-DURATION table field - Proxy Data Element (generated)
▼
Description: Proxy Data Element (generated) Field Name: DURATION Data Element: ISU_DURATION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DURATION
|