SAP ISFKAGG table - Generated Table for View details in SAP
Show table
SAP ISFKAGG table summary Object Name: ISFKAGG Dictionary Type: Table viewDescription: Generated Table for View
Field list for ISFKAGG table on an S/4 SAP system
Details
ISFKAGG-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
ISFKAGG-PRODUCT table field - Material Number
▼
Description: Material Number Field Name: PRODUCT Data Element: MATNR Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field PRODUCT
ISFKAGG-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: length (Dec): 0(0) Check table: T001W Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
ISFKAGG-MRPAREA table field -
▼
Description: Field Name: MRPAREA Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPAREA
ISFKAGG-PLNDINDEPRQMTTYPE table field -
▼
Description: Field Name: PLNDINDEPRQMTTYPE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLNDINDEPRQMTTYPE
ISFKAGG-PLNDINDEPRQMTVERSION table field -
▼
Description: Field Name: PLNDINDEPRQMTVERSION Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLNDINDEPRQMTVERSION
ISFKAGG-REQUIREMENTPLAN table field -
▼
Description: Field Name: REQUIREMENTPLAN Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQUIREMENTPLAN
ISFKAGG-REQUIREMENTSEGMENT table field -
▼
Description: Field Name: REQUIREMENTSEGMENT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQUIREMENTSEGMENT
ISFKAGG-PLNDINDEPRQMTSLSPLANPERIOD table field - Period Text
▼
Description: Period Text Field Name: PLNDINDEPRQMTSLSPLANPERIOD Data Element: PPH_PERIOD_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLNDINDEPRQMTSLSPLANPERIOD
ISFKAGG-SALESVOLUMEQUANTITY table field -
▼
Description: Field Name: SALESVOLUMEQUANTITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESVOLUMEQUANTITY
ISFKAGG-SALESORDERDATE table field - First Day of Month Date
▼
Description: First Day of Month Date Field Name: SALESORDERDATE Data Element: FIRSTDAYOFMONTHDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESORDERDATE
ISFKAGG-PERIODTYPE table field - Period Indicator
▼
Description: Period Indicator Field Name: PERIODTYPE Data Element: PERKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PKZ AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERIODTYPE
Search SAP tables