Details |
ISDSLSQTANCRC-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
ISDSLSQTANCRC-SALESQUOTATION table field - Sales Quotation
▼
Description: Sales Quotation Field Name: SALESQUOTATION Data Element: SALES_QUOTATION Data Type: length (Dec): 0(0) Check table: VBAK Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESQUOTATION
|
ISDSLSQTANCRC-SALESQUOTATIONITEM table field - Sales Quotation Item
▼
Description: Sales Quotation Item Field Name: SALESQUOTATIONITEM Data Element: SALES_QUOTATION_ITEM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESQUOTATIONITEM
|
ISDSLSQTANCRC-SALESQUOTATIONTYPE table field - Sales Document Type
▼
Description: Sales Document Type Field Name: SALESQUOTATIONTYPE Data Element: AUART Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AAT AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESQUOTATIONTYPE
|
ISDSLSQTANCRC-SALESORGANIZATION table field - Sales Organization
▼
Description: Sales Organization Field Name: SALESORGANIZATION Data Element: VKORG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: VKO AppClass: SHLP: C_VKORG SHLP Field: VKORG ConvExit: See all SAP tables containing field SALESORGANIZATION
|
ISDSLSQTANCRC-DISTRIBUTIONCHANNEL table field - Distribution Channel
▼
Description: Distribution Channel Field Name: DISTRIBUTIONCHANNEL Data Element: VTWEG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: VTW AppClass: SHLP: C_VTWEG SHLP Field: VTWEG ConvExit: See all SAP tables containing field DISTRIBUTIONCHANNEL
|
ISDSLSQTANCRC-ORGANIZATIONDIVISION table field - Division
▼
Description: Division Field Name: ORGANIZATIONDIVISION Data Element: SPART Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: SPA AppClass: SHLP: C_SPART SHLP Field: SPART ConvExit: See all SAP tables containing field ORGANIZATIONDIVISION
|
ISDSLSQTANCRC-SALESOFFICE table field - Sales Office
▼
Description: Sales Office Field Name: SALESOFFICE Data Element: VKBUR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: VKB AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESOFFICE
|
ISDSLSQTANCRC-SALESGROUP table field - Sales Group
▼
Description: Sales Group Field Name: SALESGROUP Data Element: VKGRP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: VKG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESGROUP
|
ISDSLSQTANCRC-PARTNERCOMPANY table field - Company ID of Trading Partner
▼
Description: Company ID of Trading Partner Field Name: PARTNERCOMPANY Data Element: RASSC Data Type: length (Dec): 0(0) Check table: T880 Conversion Routine: Domain Name: MemoryID: PGS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARTNERCOMPANY
|
ISDSLSQTANCRC-SOLDTOPARTY table field - Sold-to Party
▼
Description: Sold-to Party Field Name: SOLDTOPARTY Data Element: KUNAG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: VAG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOLDTOPARTY
|
ISDSLSQTANCRC-RESPONSIBLEEMPLOYEE table field - Employee Responsible
▼
Description: Employee Responsible Field Name: RESPONSIBLEEMPLOYEE Data Element: RESP_EMPL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RESPONSIBLEEMPLOYEE
|
ISDSLSQTANCRC-SALESEMPLOYEE table field - Sales Employee
▼
Description: Sales Employee Field Name: SALESEMPLOYEE Data Element: SALES_EMPL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESEMPLOYEE
|
ISDSLSQTANCRC-CREATIONDATE table field - Record Created On
▼
Description: Record Created On Field Name: CREATIONDATE Data Element: ERDAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATE
|
ISDSLSQTANCRC-BINDINGPERIODVALIDITYSTARTDATE table field - Quotation/Inquiry is Valid From
▼
Description: Quotation/Inquiry is Valid From Field Name: BINDINGPERIODVALIDITYSTARTDATE Data Element: ANGDT_V Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BINDINGPERIODVALIDITYSTARTDATE
|
ISDSLSQTANCRC-BINDINGPERIODVALIDITYENDDATE table field - Date Until Which Bid/Quotation is Binding (Valid-To Date)
▼
Description: Date Until Which Bid/Quotation is Binding (Valid-To Date) Field Name: BINDINGPERIODVALIDITYENDDATE Data Element: BNDDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BINDINGPERIODVALIDITYENDDATE
|
ISDSLSQTANCRC-MATERIAL table field - Material Number
▼
Description: Material Number Field Name: MATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field MATERIAL
|
ISDSLSQTANCRC-PRODUCT table field - Product Number
▼
Description: Product Number Field Name: PRODUCT Data Element: PRODUCTNUMBER Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field PRODUCT
|
ISDSLSQTANCRC-TRANSACTIONCURRENCY table field - SD Document Currency
▼
Description: SD Document Currency Field Name: TRANSACTIONCURRENCY Data Element: WAERK Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: FWS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSACTIONCURRENCY
|
ISDSLSQTANCRC-DISPLAYCURRENCY table field - Display Currency
▼
Description: Display Currency Field Name: DISPLAYCURRENCY Data Element: VDM_V_DISPLAY_CURRENCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DISPLAYCURRENCY
|
ISDSLSQTANCRC-SALESQUOTATIONNETAMOUNT table field - Net Value of the Document Item in Document Currency
▼
Description: Net Value of the Document Item in Document Currency Field Name: SALESQUOTATIONNETAMOUNT Data Element: NETWR_AP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESQUOTATIONNETAMOUNT
|
ISDSLSQTANCRC-CNVRTDSALESQUOTATIONNETAMOUNT table field - Converted Sales Quotation Net Amount
▼
Description: Converted Sales Quotation Net Amount Field Name: CNVRTDSALESQUOTATIONNETAMOUNT Data Element: CNVRTD_SLS_QTAN_NET_AMOUNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNVRTDSALESQUOTATIONNETAMOUNT
|
ISDSLSQTANCRC-SALESQUOTATIONNETAMTINDSPCRCY table field - Sales Quotation Net Amount In Display Currency
▼
Description: Sales Quotation Net Amount In Display Currency Field Name: SALESQUOTATIONNETAMTINDSPCRCY Data Element: SLS_QTAN_NET_AMT_IN_DC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESQUOTATIONNETAMTINDSPCRCY
|
ISDSLSQTANCRC-CNVRTDSALESQTANNETAMTINDSPCRCY table field - Converted Sales Quoation Net Amount in Display Currency
▼
Description: Converted Sales Quoation Net Amount in Display Currency Field Name: CNVRTDSALESQTANNETAMTINDSPCRCY Data Element: CNVRTD_SLS_QTAN_NET_AMT_IN_DC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNVRTDSALESQTANNETAMTINDSPCRCY
|
ISDSLSQTANCRC-SLSQTANPERIODELAPSEDPERCENT table field - Sales Quotation Period Elapsed Percent
▼
Description: Sales Quotation Period Elapsed Percent Field Name: SLSQTANPERIODELAPSEDPERCENT Data Element: SLS_QTAN_PERIOD_ELPSD_PERCENT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SLSQTANPERIODELAPSEDPERCENT
|
ISDSLSQTANCRC-SLSQTANPERIODDUEDAYS table field - Next Action in Days
▼
Description: Next Action in Days Field Name: SLSQTANPERIODDUEDAYS Data Element: DUE_DAYS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SLSQTANPERIODDUEDAYS
|
ISDSLSQTANCRC-PRDTVSLSQTANCNVRSNRATE table field - Predicted Sales Quotation Conversion Rate
▼
Description: Predicted Sales Quotation Conversion Rate Field Name: PRDTVSLSQTANCNVRSNRATE Data Element: PRDTVSLSQTANCNVRSNRATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRDTVSLSQTANCNVRSNRATE
|
ISDSLSQTANCRC-PRDTVSLSQTANCNVRSNAMOUNT table field - Predicted Order Value in Transaction Currency
▼
Description: Predicted Order Value in Transaction Currency Field Name: PRDTVSLSQTANCNVRSNAMOUNT Data Element: PRDTVSLSQTANCNVRSNAMOUNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRDTVSLSQTANCNVRSNAMOUNT
|
ISDSLSQTANCRC-PRDTVSLSQTANCNVRSNAMTINDSPCRCY table field - Predicted Order Value in Display Currency
▼
Description: Predicted Order Value in Display Currency Field Name: PRDTVSLSQTANCNVRSNAMTINDSPCRCY Data Element: CNVRTD_SLS_QT_PR_NET_AMT_IN_DC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRDTVSLSQTANCNVRSNAMTINDSPCRCY
|