Details |
IPVCONTRACTVH-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
IPVCONTRACTVH-PRACONTRACT table field - Contract Number
▼
Description: Contract Number Field Name: PRACONTRACT Data Element: OIU_CT_NO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_CID AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRACONTRACT
|
IPVCONTRACTVH-PRACONTRACTDESC table field - Contract Description
▼
Description: Contract Description Field Name: PRACONTRACTDESC Data Element: OIU_VDM_CONTRACT_DESCRIPTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRACONTRACTDESC
|
IPVCONTRACTVH-PRACONTRACTDATE table field - Document Date (Date Received/Sent)
▼
Description: Document Date (Date Received/Sent) Field Name: PRACONTRACTDATE Data Element: AUDAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRACONTRACTDATE
|
IPVCONTRACTVH-SOLDTOPARTY table field - Sold-to Party
▼
Description: Sold-to Party Field Name: SOLDTOPARTY Data Element: KUNAG Data Type: length (Dec): 0(0) Check table: KNA1 Conversion Routine: Domain Name: MemoryID: VAG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOLDTOPARTY
|
IPVCONTRACTVH-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: FIS_BUKRS Data Type: length (Dec): 0(0) Check table: T001 Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
IPVCONTRACTVH-PRACONTRACTTYPE table field - Contract Type
▼
Description: Contract Type Field Name: PRACONTRACTTYPE Data Element: OIU_CT_TYPE_CD Data Type: length (Dec): 0(0) Check table: OIU_CM_CTTYP Conversion Routine: Domain Name: MemoryID: OIU_CTY AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRACONTRACTTYPE
|
IPVCONTRACTVH-ISAPPROVED table field - Approval indicator
▼
Description: Approval indicator Field Name: ISAPPROVED Data Element: OIU_APPL_FL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISAPPROVED
|
IPVCONTRACTVH-PREVIOUSPRACONTRACT table field - Old / Previous Contract Number
▼
Description: Old / Previous Contract Number Field Name: PREVIOUSPRACONTRACT Data Element: OIU_PREV_CT_NO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PREVIOUSPRACONTRACT
|
IPVCONTRACTVH-CUSTOMERORSUPPLIERTYPE table field - Customer/Vendor Indicator
▼
Description: Customer/Vendor Indicator Field Name: CUSTOMERORSUPPLIERTYPE Data Element: OIU_CUST_VEND_CD Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: OIU_CUST_VEND_CD MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMERORSUPPLIERTYPE
|
IPVCONTRACTVH-MARKETINGREP table field - Marketing Representative No
▼
Description: Marketing Representative No Field Name: MARKETINGREP Data Element: OIU_MK_REP_NO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_MK_REP AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MARKETINGREP
|
IPVCONTRACTVH-MARKETINGREPINTRSTSEQUNMBR table field - Marketing Representative Interest Sequence No
▼
Description: Marketing Representative Interest Sequence No Field Name: MARKETINGREPINTRSTSEQUNMBR Data Element: OIU_MK_REP_ISQ_NO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_MK_REP_ISQ AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MARKETINGREPINTRSTSEQUNMBR
|
IPVCONTRACTVH-MARKETINGREPNAME table field - Marketing Representative Name
▼
Description: Marketing Representative Name Field Name: MARKETINGREPNAME Data Element: OIU_VDM_MARKETING_REP_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MARKETINGREPNAME
|
IPVCONTRACTVH-MARKETINGREPCUSTOMER table field - Marketing Representative Customer
▼
Description: Marketing Representative Customer Field Name: MARKETINGREPCUSTOMER Data Element: OIU_VDM_MARKETING_REP_CUST Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MARKETINGREPCUSTOMER
|
IPVCONTRACTVH-MARKETINGREPSUPPLIER table field - Marketing Representative Supplier
▼
Description: Marketing Representative Supplier Field Name: MARKETINGREPSUPPLIER Data Element: OIU_VDM_MARKETING_REP_SUPPL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MARKETINGREPSUPPLIER
|
IPVCONTRACTVH-CREATEDBYUSER table field - Name of Person Responsible for Creating the Object
▼
Description: Name of Person Responsible for Creating the Object Field Name: CREATEDBYUSER Data Element: ERNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
IPVCONTRACTVH-CREATIONDATE table field - Record Created On
▼
Description: Record Created On Field Name: CREATIONDATE Data Element: ERDAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATE
|
IPVCONTRACTVH-CREATIONTIME table field - Creation Time
▼
Description: Creation Time Field Name: CREATIONTIME Data Element: OIU_VDM_CREATION_TIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONTIME
|