Details |
IPRATACTWCC-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
IPRATACTWCC-PRATSTALLOCVERSION table field - Unique Version ID
▼
Description: Unique Version ID Field Name: PRATSTALLOCVERSION Data Element: /PRA/VERSION_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRATSTALLOCVERSION
|
IPRATACTWCC-DELIVERYNETWORK table field - Delivery network number
▼
Description: Delivery network number Field Name: DELIVERYNETWORK Data Element: OIU_DN_NO Data Type: CHAR length (Dec): 20(0) Check table: OIU_PR_DN Conversion Routine: ALPHA Domain Name: OIU_DN_NO MemoryID: OIU_DN AppClass: SHLP: H_OIU_PR_DN SHLP Field: DN_NO ConvExit: ALPHA See all SAP tables containing field DELIVERYNETWORK
|
IPRATACTWCC-WELL table field - Well ID number
▼
Description: Well ID number Field Name: WELL Data Element: OIU_WL_NO Data Type: length (Dec): 0(0) Check table: OIU_PR_WELL Conversion Routine: Domain Name: MemoryID: OIU_WELL AppClass: SHLP: H_OIU_PR_WELL SHLP Field: WL_NO ConvExit: See all SAP tables containing field WELL
|
IPRATACTWCC-WELLCOMPLETION table field - Well Completion Number
▼
Description: Well Completion Number Field Name: WELLCOMPLETION Data Element: OIU_WC_NO Data Type: length (Dec): 0(0) Check table: OIU_PR_WC Conversion Routine: Domain Name: MemoryID: OIU_WC AppClass: SHLP: H_OIU_PR_WC SHLP Field: WC_NO ConvExit: See all SAP tables containing field WELLCOMPLETION
|
IPRATACTWCC-MATERIAL table field - Material Number
▼
Description: Material Number Field Name: MATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: OIU_CM_MAT_PRCD Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field MATERIAL
|
IPRATACTWCC-PRACONTRACT table field - Contract Number
▼
Description: Contract Number Field Name: PRACONTRACT Data Element: OIU_CT_NO Data Type: length (Dec): 0(0) Check table: OIU_RV_CT Conversion Routine: Domain Name: MemoryID: OIU_CID AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRACONTRACT
|
IPRATACTWCC-SALESDATE table field - Sales date
▼
Description: Sales date Field Name: SALESDATE Data Element: OIU_SA_DT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_PRD_DATE AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESDATE
|
IPRATACTWCC-PRAOWNER table field - PRA owner
▼
Description: PRA owner Field Name: PRAOWNER Data Element: OIU_OWN_NO Data Type: length (Dec): 0(0) Check table: LFA1 Conversion Routine: Domain Name: MemoryID: OIU_OWN_NO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRAOWNER
|
IPRATACTWCC-OWNERINTERESTTYPE table field - Participant Interest Type
▼
Description: Participant Interest Type Field Name: OWNERINTERESTTYPE Data Element: OIU_PART_INT_TYPE Data Type: length (Dec): 0(0) Check table: OIU_CM_PINTTY Conversion Routine: Domain Name: MemoryID: OIU_PART_INT_TYPE AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OWNERINTERESTTYPE
|
IPRATACTWCC-OWNERINTERESTSEQUENCE table field - Owner Interest Sequence Number
▼
Description: Owner Interest Sequence Number Field Name: OWNERINTERESTSEQUENCE Data Element: OIU_OWN_ISQ_NO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_OWN_ISQ_NO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OWNERINTERESTSEQUENCE
|
IPRATACTWCC-ORIGINATINGMEASUREMENTPT table field - Original measurement point number
▼
Description: Original measurement point number Field Name: ORIGINATINGMEASUREMENTPT Data Element: OIU_ORIG_MP_NO Data Type: length (Dec): 0(0) Check table: OIU_PR_MP Conversion Routine: Domain Name: MemoryID: OIU_ORIG_MP_NO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORIGINATINGMEASUREMENTPT
|
IPRATACTWCC-TRANSPORTER table field - Transporter number
▼
Description: Transporter number Field Name: TRANSPORTER Data Element: OIU_TRNSP_NO Data Type: length (Dec): 0(0) Check table: KNA1 Conversion Routine: Domain Name: MemoryID: OIU_TRNSP_NO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSPORTER
|
IPRATACTWCC-ALLOCATIONFREQUENCY table field - Frequency
▼
Description: Frequency Field Name: ALLOCATIONFREQUENCY Data Element: OIU_FREQ_CD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_FRQ AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ALLOCATIONFREQUENCY
|
IPRATACTWCC-MAJORPRODUCT table field - Major product code
▼
Description: Major product code Field Name: MAJORPRODUCT Data Element: OIU_MAJPD_CD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_MAJPD AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAJORPRODUCT
|
IPRATACTWCC-BASELINEACTUALVOLUME table field - Actual Volume
▼
Description: Actual Volume Field Name: BASELINEACTUALVOLUME Data Element: OIU_ACTL_VOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASELINEACTUALVOLUME
|
IPRATACTWCC-ACTUALVOLUME table field - Actual Volume
▼
Description: Actual Volume Field Name: ACTUALVOLUME Data Element: OIU_ACTL_VOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTUALVOLUME
|
IPRATACTWCC-ACTUALVOLUMEDIFFPCT table field -
▼
Description: Field Name: ACTUALVOLUMEDIFFPCT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTUALVOLUMEDIFFPCT
|
IPRATACTWCC-VOLUMEUNIT table field - Actual Volume Units
▼
Description: Actual Volume Units Field Name: VOLUMEUNIT Data Element: OIU_ACTL_VOL_U Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VOLUMEUNIT
|
IPRATACTWCC-BASELINEACTUALHEATINGVALUE table field - Heating value
▼
Description: Heating value Field Name: BASELINEACTUALHEATINGVALUE Data Element: OIU_HEAT_VAL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASELINEACTUALHEATINGVALUE
|
IPRATACTWCC-ACTUALHEATINGVALUE table field - Heating value
▼
Description: Heating value Field Name: ACTUALHEATINGVALUE Data Element: OIU_HEAT_VAL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTUALHEATINGVALUE
|
IPRATACTWCC-ACTUALHEATINGVALUEDIFFVAL table field -
▼
Description: Field Name: ACTUALHEATINGVALUEDIFFVAL Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTUALHEATINGVALUEDIFFVAL
|
IPRATACTWCC-HEATINGVALUNIT table field - Heating Value Unit
▼
Description: Heating Value Unit Field Name: HEATINGVALUNIT Data Element: OIU_HEAT_VAL_U Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: OUMH SHLP Field: MSEHI ConvExit: See all SAP tables containing field HEATINGVALUNIT
|
IPRATACTWCC-BASELINEACTUALENERGY table field - Actual Energy
▼
Description: Actual Energy Field Name: BASELINEACTUALENERGY Data Element: OIU_ACTL_ENERGY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASELINEACTUALENERGY
|
IPRATACTWCC-ACTUALENERGY table field - Actual Energy
▼
Description: Actual Energy Field Name: ACTUALENERGY Data Element: OIU_ACTL_ENERGY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTUALENERGY
|
IPRATACTWCC-ACTUALENERGYDIFFVAL table field -
▼
Description: Field Name: ACTUALENERGYDIFFVAL Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTUALENERGYDIFFVAL
|
IPRATACTWCC-ENERGYUNIT table field - Actual Energy Unit
▼
Description: Actual Energy Unit Field Name: ENERGYUNIT Data Element: OIU_ACTL_ENERGY_U Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENERGYUNIT
|
IPRATACTWCC-BASELINEWETGASOVERRIDEPCT table field - Wet Gas Override Percent
▼
Description: Wet Gas Override Percent Field Name: BASELINEWETGASOVERRIDEPCT Data Element: OIU_WG_OVRD_PC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASELINEWETGASOVERRIDEPCT
|
IPRATACTWCC-WETGASOVERRIDEPCT table field - Wet Gas Override Percent
▼
Description: Wet Gas Override Percent Field Name: WETGASOVERRIDEPCT Data Element: OIU_WG_OVRD_PC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WETGASOVERRIDEPCT
|
IPRATACTWCC-WETGASOVERRIDEPCTDIFFVAL table field -
▼
Description: Field Name: WETGASOVERRIDEPCTDIFFVAL Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WETGASOVERRIDEPCTDIFFVAL
|
IPRATACTWCC-BASELINEENTITLEDVOLUME table field - Entitled Contract Volume
▼
Description: Entitled Contract Volume Field Name: BASELINEENTITLEDVOLUME Data Element: OIU_ENTL_CT_VOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASELINEENTITLEDVOLUME
|
IPRATACTWCC-ENTITLEDVOLUME table field - Entitled Contract Volume
▼
Description: Entitled Contract Volume Field Name: ENTITLEDVOLUME Data Element: OIU_ENTL_CT_VOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENTITLEDVOLUME
|
IPRATACTWCC-ENTITLEDVOLUMEDIFFVAL table field -
▼
Description: Field Name: ENTITLEDVOLUMEDIFFVAL Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENTITLEDVOLUMEDIFFVAL
|
IPRATACTWCC-BASELINEADJUSTEDENTITLEDVOL table field - Adjusted Entitled Contract Volume
▼
Description: Adjusted Entitled Contract Volume Field Name: BASELINEADJUSTEDENTITLEDVOL Data Element: OIU_ADJ_ENTL_CT_VOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASELINEADJUSTEDENTITLEDVOL
|
IPRATACTWCC-ADJUSTEDENTITLEDVOL table field - Adjusted Entitled Contract Volume
▼
Description: Adjusted Entitled Contract Volume Field Name: ADJUSTEDENTITLEDVOL Data Element: OIU_ADJ_ENTL_CT_VOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADJUSTEDENTITLEDVOL
|
IPRATACTWCC-ADJUSTEDENTITLEDVOLDIFFVAL table field -
▼
Description: Field Name: ADJUSTEDENTITLEDVOLDIFFVAL Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADJUSTEDENTITLEDVOLDIFFVAL
|
IPRATACTWCC-BASELINEENTITLEDENERGY table field - Entitled Contract Energy
▼
Description: Entitled Contract Energy Field Name: BASELINEENTITLEDENERGY Data Element: OIU_ENTL_CT_ENER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASELINEENTITLEDENERGY
|
IPRATACTWCC-ENTITLEDENERGY table field - Entitled Contract Energy
▼
Description: Entitled Contract Energy Field Name: ENTITLEDENERGY Data Element: OIU_ENTL_CT_ENER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENTITLEDENERGY
|
IPRATACTWCC-ENTITLEDENERGYDIFFVAL table field -
▼
Description: Field Name: ENTITLEDENERGYDIFFVAL Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENTITLEDENERGYDIFFVAL
|
IPRATACTWCC-BASELINEADJUSTEDENTITLEDENGY table field - Adjusted Entitled Contract Energy
▼
Description: Adjusted Entitled Contract Energy Field Name: BASELINEADJUSTEDENTITLEDENGY Data Element: OIU_ADJ_ENTL_CT_ENER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASELINEADJUSTEDENTITLEDENGY
|
IPRATACTWCC-ADJUSTEDENTITLEDENGY table field - Adjusted Entitled Contract Energy
▼
Description: Adjusted Entitled Contract Energy Field Name: ADJUSTEDENTITLEDENGY Data Element: OIU_ADJ_ENTL_CT_ENER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADJUSTEDENTITLEDENGY
|
IPRATACTWCC-ADJUSTEDENTITLEDENGYDIFFVAL table field -
▼
Description: Field Name: ADJUSTEDENTITLEDENGYDIFFVAL Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADJUSTEDENTITLEDENGYDIFFVAL
|
IPRATACTWCC-CREATEDBYUSER table field - Name of Person Responsible for Creating the Object
▼
Description: Name of Person Responsible for Creating the Object Field Name: CREATEDBYUSER Data Element: ERNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
IPRATACTWCC-CREATIONDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CREATIONDATETIME Data Element: TZNTSTMPS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATETIME
|
IPRATACTWCC-SEQUENCENUMBER table field -
▼
Description: Field Name: SEQUENCENUMBER Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SEQUENCENUMBER
|
IPRATACTWCC-ACTUALVOLUMETOLERANCEINPCT table field - Test Validation - Standard Volume Tolerance
▼
Description: Test Validation - Standard Volume Tolerance Field Name: ACTUALVOLUMETOLERANCEINPCT Data Element: OIUTV_ACTVOL_TOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTUALVOLUMETOLERANCEINPCT
|
IPRATACTWCC-ACTLHEATVALTOLERANCEVAL table field - Test Validation - Actual Heating Value Tolerance
▼
Description: Test Validation - Actual Heating Value Tolerance Field Name: ACTLHEATVALTOLERANCEVAL Data Element: OIUTV_HEATVAL_TOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTLHEATVALTOLERANCEVAL
|
IPRATACTWCC-ACTUALENGYTOLERANCEVAL table field - Test Validation - Actual Energy Tolerance
▼
Description: Test Validation - Actual Energy Tolerance Field Name: ACTUALENGYTOLERANCEVAL Data Element: OIUTV_ACTLENERGY_TOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTUALENGYTOLERANCEVAL
|
IPRATACTWCC-ENTITLEDVOLUMETOLVAL table field - Test Validation - Entitled Volume Tolerance
▼
Description: Test Validation - Entitled Volume Tolerance Field Name: ENTITLEDVOLUMETOLVAL Data Element: OIUTV_ENTVOL_TOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENTITLEDVOLUMETOLVAL
|
IPRATACTWCC-ADJDENTITLEDVOLTOLVAL table field - Test Validation - Adjusted Entitled Volume Tolerance
▼
Description: Test Validation - Adjusted Entitled Volume Tolerance Field Name: ADJDENTITLEDVOLTOLVAL Data Element: OIUTV_ADJENTVOL_TOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADJDENTITLEDVOLTOLVAL
|
IPRATACTWCC-ENTITLEDENERGYTOLVAL table field - Test Validation - Standard Volume Tolerance
▼
Description: Test Validation - Standard Volume Tolerance Field Name: ENTITLEDENERGYTOLVAL Data Element: OIUTV_ENTLENERGY_TOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENTITLEDENERGYTOLVAL
|
IPRATACTWCC-ADJDENTITLEDENGYTOLVAL table field - Test Validation - Standard Volume Tolerance
▼
Description: Test Validation - Standard Volume Tolerance Field Name: ADJDENTITLEDENGYTOLVAL Data Element: OIUTV_ADJENTLENERGY_TOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADJDENTITLEDENGYTOLVAL
|