Details |
IPHYINVVMRFLD-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
IPHYINVVMRFLD-CREATIONDATETIME table field - Timestamp for posting documents
▼
Description: Timestamp for posting documents Field Name: CREATIONDATETIME Data Element: OIB_TIMESTAMP Data Type: NUMC length (Dec): 14(0) Check table: Conversion Routine: Domain Name: OII_TIMEST MemoryID: AppClass: SDIC SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATETIME
|
IPHYINVVMRFLD-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: length (Dec): 0(0) Check table: T001W Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
|
IPHYINVVMRFLD-EXTERNALPLANT table field - Third Party Specific Plant ID
▼
Description: Third Party Specific Plant ID Field Name: EXTERNALPLANT Data Element: OIB_02_CWERKS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXTERNALPLANT
|
IPHYINVVMRFLD-MATERIAL table field - Material Number
▼
Description: Material Number Field Name: MATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field MATERIAL
|
IPHYINVVMRFLD-EXTERNALMATERIAL table field - Third Party Specific Material
▼
Description: Third Party Specific Material Field Name: EXTERNALMATERIAL Data Element: OIB_02_MATNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXTERNALMATERIAL
|
IPHYINVVMRFLD-LOCATION table field - Storage Location
▼
Description: Storage Location Field Name: LOCATION Data Element: LGORT_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: LAG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LOCATION
|
IPHYINVVMRFLD-SEQUENCENUMBER table field -
▼
Description: Field Name: SEQUENCENUMBER Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SEQUENCENUMBER
|
IPHYINVVMRFLD-EVENTOFINVENTORY table field - Event of Inventory (GR, Volume, Mass)
▼
Description: Event of Inventory (GR, Volume, Mass) Field Name: EVENTOFINVENTORY Data Element: OIB_02_DIP_EVENTKEY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EVENTOFINVENTORY
|
IPHYINVVMRFLD-TANKDIPTOTALHEIGHT table field - Tank dip, total height
▼
Description: Tank dip, total height Field Name: TANKDIPTOTALHEIGHT Data Element: OII_TOTALHEIGHT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TANKDIPTOTALHEIGHT
|
IPHYINVVMRFLD-TANKDIPUNITOFMEASURE table field - Length UoM (Oil BDRP)
▼
Description: Length UoM (Oil BDRP) Field Name: TANKDIPUNITOFMEASURE Data Element: OII_LENUN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TANKDIPUNITOFMEASURE
|
IPHYINVVMRFLD-TANKDIPUNITOFMEASURECHAR table field -
▼
Description: Field Name: TANKDIPUNITOFMEASURECHAR Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TANKDIPUNITOFMEASURECHAR
|
IPHYINVVMRFLD-TANKDIPWATERHEIGHT table field - Tank dip: water dip height
▼
Description: Tank dip: water dip height Field Name: TANKDIPWATERHEIGHT Data Element: OII_WATERHEIGHT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TANKDIPWATERHEIGHT
|
IPHYINVVMRFLD-TANKDIPWATERHEIGHTUOM table field - Length UoM (Oil BDRP)
▼
Description: Length UoM (Oil BDRP) Field Name: TANKDIPWATERHEIGHTUOM Data Element: OII_LENUN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TANKDIPWATERHEIGHTUOM
|
IPHYINVVMRFLD-TANKDIPWATERHEIGHTUOMCHAR table field -
▼
Description: Field Name: TANKDIPWATERHEIGHTUOMCHAR Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TANKDIPWATERHEIGHTUOMCHAR
|
IPHYINVVMRFLD-DIPPINGMETHODINNAGEULLAGE table field - Dipping method (innage, ullage)
▼
Description: Dipping method (innage, ullage) Field Name: DIPPINGMETHODINNAGEULLAGE Data Element: OII_UL_IN_IND Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DIPPINGMETHODINNAGEULLAGE
|
IPHYINVVMRFLD-PHYINVQUANTITY table field - Material Volume
▼
Description: Material Volume Field Name: PHYINVQUANTITY Data Element: OIB_02_QUAN_VOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PHYINVQUANTITY
|
IPHYINVVMRFLD-PHYINVQUANTITYUOM table field - UoM - volumetric constant for lin./vol. conversion (BDRP)
▼
Description: UoM - volumetric constant for lin./vol. conversion (BDRP) Field Name: PHYINVQUANTITYUOM Data Element: OII_VOLUNC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PHYINVQUANTITYUOM
|
IPHYINVVMRFLD-PHYINVQUANTITYEXTUOM table field -
▼
Description: Field Name: PHYINVQUANTITYEXTUOM Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PHYINVQUANTITYEXTUOM
|
IPHYINVVMRFLD-MATERIALVOLUME table field - Material Volume
▼
Description: Material Volume Field Name: MATERIALVOLUME Data Element: OIB_02_QUAN_VOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALVOLUME
|
IPHYINVVMRFLD-MATERIALVOLUMEUOM table field - UoM - volumetric constant for lin./vol. conversion (BDRP)
▼
Description: UoM - volumetric constant for lin./vol. conversion (BDRP) Field Name: MATERIALVOLUMEUOM Data Element: OII_VOLUNC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALVOLUMEUOM
|
IPHYINVVMRFLD-MATERIALVOLUMEUOMCHAR table field -
▼
Description: Field Name: MATERIALVOLUMEUOMCHAR Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALVOLUMEUOMCHAR
|
IPHYINVVMRFLD-MATERIALMASS table field - Mass/ weight
▼
Description: Mass/ weight Field Name: MATERIALMASS Data Element: OIB_02_QUAN_MASS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALMASS
|
IPHYINVVMRFLD-MATERIALMASSUOM table field - UoM - mass (Oil BDRP)
▼
Description: UoM - mass (Oil BDRP) Field Name: MATERIALMASSUOM Data Element: OII_MASUN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALMASSUOM
|
IPHYINVVMRFLD-MATERIALMASSUOMCHAR table field -
▼
Description: Field Name: MATERIALMASSUOMCHAR Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALMASSUOMCHAR
|
IPHYINVVMRFLD-DATERECORDCREATED table field - Date record created
▼
Description: Date record created Field Name: DATERECORDCREATED Data Element: OII_ERDAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DATERECORDCREATED
|
IPHYINVVMRFLD-TIMERECORDCREATED table field - Time record created
▼
Description: Time record created Field Name: TIMERECORDCREATED Data Element: OII_ERZEIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TIMERECORDCREATED
|
IPHYINVVMRFLD-CREATEDBYUSER table field - User who created record
▼
Description: User who created record Field Name: CREATEDBYUSER Data Element: OII_ERNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
IPHYINVVMRFLD-ISDELETED table field - Deletion indicator
▼
Description: Deletion indicator Field Name: ISDELETED Data Element: OII_DELIND Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISDELETED
|
IPHYINVVMRFLD-ISALLOCATIONCOMPLETION table field - Allocation completion indicator
▼
Description: Allocation completion indicator Field Name: ISALLOCATIONCOMPLETION Data Element: OIB_02_ALLOC_STAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISALLOCATIONCOMPLETION
|
IPHYINVVMRFLD-ISRECONCILIATIONCOMPLETION table field - Reconcelliation completion indicator
▼
Description: Reconcelliation completion indicator Field Name: ISRECONCILIATIONCOMPLETION Data Element: OIB_02_RECON_STAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISRECONCILIATIONCOMPLETION
|
IPHYINVVMRFLD-MATERIALDESCRIPTION table field - Text, 40 Characters Long
▼
Description: Text, 40 Characters Long Field Name: MATERIALDESCRIPTION Data Element: TEXT40 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALDESCRIPTION
|
IPHYINVVMRFLD-OILTIMESTAMPDISPLAY table field - Timestamp for posting documents
▼
Description: Timestamp for posting documents Field Name: OILTIMESTAMPDISPLAY Data Element: OIB_TIMESTAMP Data Type: NUMC length (Dec): 14(0) Check table: Conversion Routine: Domain Name: OII_TIMEST MemoryID: AppClass: SDIC SHLP: SHLP Field: ConvExit: See all SAP tables containing field OILTIMESTAMPDISPLAY
|
IPHYINVVMRFLD-CREATIONDATETIMEDCML table field -
▼
Description: Field Name: CREATIONDATETIMEDCML Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATETIMEDCML
|
IPHYINVVMRFLD-CURRENTSYSTEMUTCDATETIME table field -
▼
Description: Field Name: CURRENTSYSTEMUTCDATETIME Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CURRENTSYSTEMUTCDATETIME
|
IPHYINVVMRFLD-STARTDATE table field -
▼
Description: Field Name: STARTDATE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STARTDATE
|