Details |
IMMQTNITEMENHWD-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
IMMQTNITEMENHWD-SUPPLIERQUOTATION table field - Purchasing Document Number
▼
Description: Purchasing Document Number Field Name: SUPPLIERQUOTATION Data Element: EBELN Data Type: length (Dec): 0(0) Check table: EKKO Conversion Routine: Domain Name: MemoryID: BES AppClass: SHLP: MEKK_C SHLP Field: EBELN ConvExit: See all SAP tables containing field SUPPLIERQUOTATION
|
IMMQTNITEMENHWD-SUPPLIERQUOTATIONITEM table field - Item Number of Supplier Quotation
▼
Description: Item Number of Supplier Quotation Field Name: SUPPLIERQUOTATIONITEM Data Element: VDM_SUPPLIERQUOTATIONITEM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BSP AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLIERQUOTATIONITEM
|
IMMQTNITEMENHWD-PURCHASINGDOCUMENTCATEGORY table field - Purchasing Document Category
▼
Description: Purchasing Document Category Field Name: PURCHASINGDOCUMENTCATEGORY Data Element: BSTYP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGDOCUMENTCATEGORY
|
IMMQTNITEMENHWD-PURCHASINGDOCUMENTITEMTEXT table field - Short Text
▼
Description: Short Text Field Name: PURCHASINGDOCUMENTITEMTEXT Data Element: TXZ01 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGDOCUMENTITEMTEXT
|
IMMQTNITEMENHWD-MATERIAL table field - Material Number
▼
Description: Material Number Field Name: MATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field MATERIAL
|
IMMQTNITEMENHWD-PRODUCTTYPE table field - Product Type Group
▼
Description: Product Type Group Field Name: PRODUCTTYPE Data Element: PRODUCT_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTTYPE
|
IMMQTNITEMENHWD-MANUFACTURERMATERIAL table field - Material number
▼
Description: Material number Field Name: MANUFACTURERMATERIAL Data Element: EMATNR Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANUFACTURERMATERIAL
|
IMMQTNITEMENHWD-SUPPLIERMATERIALNUMBER table field - Material Number Used by Supplier
▼
Description: Material Number Used by Supplier Field Name: SUPPLIERMATERIALNUMBER Data Element: IDNLF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLIERMATERIALNUMBER
|
IMMQTNITEMENHWD-MANUFACTURERPARTNMBR table field - Manufacturer Part Number
▼
Description: Manufacturer Part Number Field Name: MANUFACTURERPARTNMBR Data Element: MFRPN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANUFACTURERPARTNMBR
|
IMMQTNITEMENHWD-MANUFACTURER table field - Number of a Manufacturer
▼
Description: Number of a Manufacturer Field Name: MANUFACTURER Data Element: MFRNR Data Type: length (Dec): 0(0) Check table: LFA1 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANUFACTURER
|
IMMQTNITEMENHWD-MATERIALGROUP table field - Material Group
▼
Description: Material Group Field Name: MATERIALGROUP Data Element: MATKL Data Type: length (Dec): 0(0) Check table: T023 Conversion Routine: Domain Name: MemoryID: MKL AppClass: SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATERIALGROUP
|
IMMQTNITEMENHWD-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: EWERK Data Type: length (Dec): 0(0) Check table: T001W Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANT
|
IMMQTNITEMENHWD-MANUALDELIVERYADDRESSID table field - Manual address number in purchasing document item
▼
Description: Manual address number in purchasing document item Field Name: MANUALDELIVERYADDRESSID Data Element: ADRNR_MM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANUALDELIVERYADDRESSID
|
IMMQTNITEMENHWD-REFERENCEDELIVERYADDRESSID table field - Number of delivery address
▼
Description: Number of delivery address Field Name: REFERENCEDELIVERYADDRESSID Data Element: ADRN2 Data Type: length (Dec): 0(0) Check table: ADRC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REFERENCEDELIVERYADDRESSID
|
IMMQTNITEMENHWD-ADDRESSID table field - Address
▼
Description: Address Field Name: ADDRESSID Data Element: ADRNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADDRESSID
|
IMMQTNITEMENHWD-ITEMDELIVERYADDRESSID table field - Manual address number in purchasing document item
▼
Description: Manual address number in purchasing document item Field Name: ITEMDELIVERYADDRESSID Data Element: ADRNR_MM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ITEMDELIVERYADDRESSID
|
IMMQTNITEMENHWD-INCOTERMSCLASSIFICATION table field - Incoterms (Part 1)
▼
Description: Incoterms (Part 1) Field Name: INCOTERMSCLASSIFICATION Data Element: INCO1 Data Type: length (Dec): 0(0) Check table: TINC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INCOTERMSCLASSIFICATION
|
IMMQTNITEMENHWD-INCOTERMSTRANSFERLOCATION table field - Incoterms (Part 2)
▼
Description: Incoterms (Part 2) Field Name: INCOTERMSTRANSFERLOCATION Data Element: INCO2 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INCOTERMSTRANSFERLOCATION
|
IMMQTNITEMENHWD-INCOTERMSLOCATION1 table field - Incoterms Location 1
▼
Description: Incoterms Location 1 Field Name: INCOTERMSLOCATION1 Data Element: INCO2_L Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INCOTERMSLOCATION1
|
IMMQTNITEMENHWD-INCOTERMSLOCATION2 table field - Incoterms Location 2
▼
Description: Incoterms Location 2 Field Name: INCOTERMSLOCATION2 Data Element: INCO3_L Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INCOTERMSLOCATION2
|
IMMQTNITEMENHWD-SCHEDULELINEDELIVERYDATE table field - Delivery Date
▼
Description: Delivery Date Field Name: SCHEDULELINEDELIVERYDATE Data Element: MM_A_DELIVERY_DATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SCHEDULELINEDELIVERYDATE
|
IMMQTNITEMENHWD-SCHEDULELINEORDERQUANTITY table field - Scheduled Quantity
▼
Description: Scheduled Quantity Field Name: SCHEDULELINEORDERQUANTITY Data Element: ETMEN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SCHEDULELINEORDERQUANTITY
|
IMMQTNITEMENHWD-AWARDEDQUANTITY table field - Awarded Quantity
▼
Description: Awarded Quantity Field Name: AWARDEDQUANTITY Data Element: VDM_AWARDED_QUANTITY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AWARDEDQUANTITY
|
IMMQTNITEMENHWD-PERFORMANCEPERIODSTARTDATE table field - Start Date for Period of Performance
▼
Description: Start Date for Period of Performance Field Name: PERFORMANCEPERIODSTARTDATE Data Element: VDM_PERFORMANCEPERIODSTARTDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERFORMANCEPERIODSTARTDATE
|
IMMQTNITEMENHWD-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance
▼
Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: VDM_PERFORMANCEPERIODENDDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERFORMANCEPERIODENDDATE
|
IMMQTNITEMENHWD-ORDERPRICEUNIT table field - Order Price Unit (Purchasing)
▼
Description: Order Price Unit (Purchasing) Field Name: ORDERPRICEUNIT Data Element: BBPRM Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERPRICEUNIT
|
IMMQTNITEMENHWD-ORDERPRICEUNITTOORDERUNITNMRTR table field - Numerator for Conversion of Order Price Unit into Order Unit
▼
Description: Numerator for Conversion of Order Price Unit into Order Unit Field Name: ORDERPRICEUNITTOORDERUNITNMRTR Data Element: BPUMZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERPRICEUNITTOORDERUNITNMRTR
|
IMMQTNITEMENHWD-ORDPRICEUNITTOORDERUNITDNMNTR table field - Denominator for Conv. of Order Price Unit into Order Unit
▼
Description: Denominator for Conv. of Order Price Unit into Order Unit Field Name: ORDPRICEUNITTOORDERUNITDNMNTR Data Element: BPUMN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDPRICEUNITTOORDERUNITDNMNTR
|
IMMQTNITEMENHWD-ORDERQUANTITYUNIT table field - Purchase Order Unit of Measure
▼
Description: Purchase Order Unit of Measure Field Name: ORDERQUANTITYUNIT Data Element: BSTME Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERQUANTITYUNIT
|
IMMQTNITEMENHWD-ORDERITEMQTYTOBASEQTYNMRTR table field - Numerator for Conversion of Order Unit to Base Unit
▼
Description: Numerator for Conversion of Order Unit to Base Unit Field Name: ORDERITEMQTYTOBASEQTYNMRTR Data Element: UMBSZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERITEMQTYTOBASEQTYNMRTR
|
IMMQTNITEMENHWD-ORDERITEMQTYTOBASEQTYDNMNTR table field - Denominator for Conversion of Order Unit to Base Unit
▼
Description: Denominator for Conversion of Order Unit to Base Unit Field Name: ORDERITEMQTYTOBASEQTYDNMNTR Data Element: UMBSN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERITEMQTYTOBASEQTYDNMNTR
|
IMMQTNITEMENHWD-PURGDOCPRICEDATE table field - Date of Price Determination
▼
Description: Date of Price Determination Field Name: PURGDOCPRICEDATE Data Element: PREDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURGDOCPRICEDATE
|
IMMQTNITEMENHWD-BASEUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: BASEUNIT Data Element: LAGME Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASEUNIT
|
IMMQTNITEMENHWD-NETAMOUNT table field - Quotation Net Value
▼
Description: Quotation Net Value Field Name: NETAMOUNT Data Element: VDM_QTN_NET_AMOUNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NETAMOUNT
|
IMMQTNITEMENHWD-GROSSAMOUNT table field - Gross order value in PO currency
▼
Description: Gross order value in PO currency Field Name: GROSSAMOUNT Data Element: BBWERT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GROSSAMOUNT
|
IMMQTNITEMENHWD-EFFECTIVEAMOUNT table field - Effective value of item
▼
Description: Effective value of item Field Name: EFFECTIVEAMOUNT Data Element: EFFWR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EFFECTIVEAMOUNT
|
IMMQTNITEMENHWD-NETPRICEAMOUNT table field - Net Price in Purchasing Document (in Document Currency)
▼
Description: Net Price in Purchasing Document (in Document Currency) Field Name: NETPRICEAMOUNT Data Element: BPREI Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NETPRICEAMOUNT
|
IMMQTNITEMENHWD-NETPRICEQUANTITY table field - Price Unit
▼
Description: Price Unit Field Name: NETPRICEQUANTITY Data Element: VDM_PRICE_UNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NETPRICEQUANTITY
|
IMMQTNITEMENHWD-DOCUMENTCURRENCY table field - Currency Key
▼
Description: Currency Key Field Name: DOCUMENTCURRENCY Data Element: WAERS Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: FWS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTCURRENCY
|
IMMQTNITEMENHWD-PURCHASEREQUISITION table field - Purchase Requisition Number
▼
Description: Purchase Requisition Number Field Name: PURCHASEREQUISITION Data Element: BANFN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BAN AppClass: SHLP: MBAN_C SHLP Field: BANFN ConvExit: See all SAP tables containing field PURCHASEREQUISITION
|
IMMQTNITEMENHWD-PURCHASEREQUISITIONITEM table field - Item number of purchase requisition
▼
Description: Item number of purchase requisition Field Name: PURCHASEREQUISITIONITEM Data Element: BNFPO Data Type: length (Dec): 0(0) Check table: EBAN Conversion Routine: Domain Name: MemoryID: BAP AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQUISITIONITEM
|
IMMQTNITEMENHWD-REQUESTFORQUOTATION table field - Identifier for Request for Quotation
▼
Description: Identifier for Request for Quotation Field Name: REQUESTFORQUOTATION Data Element: RFQ_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQUESTFORQUOTATION
|
IMMQTNITEMENHWD-REQUESTFORQUOTATIONITEM table field - Item Number for Request for Quotation
▼
Description: Item Number for Request for Quotation Field Name: REQUESTFORQUOTATIONITEM Data Element: RFQ_ITEM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQUESTFORQUOTATIONITEM
|
IMMQTNITEMENHWD-ISINFORECORDUPDATED table field - Indicator for Info Record Update
▼
Description: Indicator for Info Record Update Field Name: ISINFORECORDUPDATED Data Element: MM_RFQ_INFREC_UPDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISINFORECORDUPDATED
|
IMMQTNITEMENHWD-PURCHASINGINFORECORDUPDATECODE table field - Indicator: Update Info Record
▼
Description: Indicator: Update Info Record Field Name: PURCHASINGINFORECORDUPDATECODE Data Element: SPINF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGINFORECORDUPDATECODE
|
IMMQTNITEMENHWD-PURCHASINGINFORECORD table field - Number of purchasing info record
▼
Description: Number of purchasing info record Field Name: PURCHASINGINFORECORD Data Element: INFNR Data Type: length (Dec): 0(0) Check table: EINA Conversion Routine: Domain Name: MemoryID: INF AppClass: SHLP: MEIN_C SHLP Field: INFNR ConvExit: See all SAP tables containing field PURCHASINGINFORECORD
|
IMMQTNITEMENHWD-PURCHASINGDOCUMENTITEMCATEGORY table field - Item category in purchasing document
▼
Description: Item category in purchasing document Field Name: PURCHASINGDOCUMENTITEMCATEGORY Data Element: PSTYP Data Type: length (Dec): 0(0) Check table: T163 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGDOCUMENTITEMCATEGORY
|
IMMQTNITEMENHWD-PURCHASINGPARENTITEM table field - Higher-Level Item in Purchasing Documents
▼
Description: Higher-Level Item in Purchasing Documents Field Name: PURCHASINGPARENTITEM Data Element: UEBPO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGPARENTITEM
|
IMMQTNITEMENHWD-ISSTATISTICALITEM table field - Item is statistical
▼
Description: Item is statistical Field Name: ISSTATISTICALITEM Data Element: STAPO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISSTATISTICALITEM
|
IMMQTNITEMENHWD-HIERARCHYNODE table field - Hierarchy node
▼
Description: Hierarchy node Field Name: HIERARCHYNODE Data Element: RSNODEEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HIERARCHYNODE
|
IMMQTNITEMENHWD-HIERARCHYPARENTNODE table field - Hierarchy node
▼
Description: Hierarchy node Field Name: HIERARCHYPARENTNODE Data Element: RSNODEEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HIERARCHYPARENTNODE
|
IMMQTNITEMENHWD-HIERARCHYLEVEL table field -
▼
Description: Field Name: HIERARCHYLEVEL Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HIERARCHYLEVEL
|
IMMQTNITEMENHWD-HIERARCHYNODESUBTREESIZE table field -
▼
Description: Field Name: HIERARCHYNODESUBTREESIZE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HIERARCHYNODESUBTREESIZE
|
IMMQTNITEMENHWD-HIERARCHYDRILLSTATE table field -
▼
Description: Field Name: HIERARCHYDRILLSTATE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HIERARCHYDRILLSTATE
|
IMMQTNITEMENHWD-HIERARCHYNODEORDINALNUMBER table field -
▼
Description: Field Name: HIERARCHYNODEORDINALNUMBER Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HIERARCHYNODEORDINALNUMBER
|
IMMQTNITEMENHWD-ISOUTLINE table field - ItemSet indicator of a Model Product Specification Item
▼
Description: ItemSet indicator of a Model Product Specification Item Field Name: ISOUTLINE Data Element: MMPUR_IS_ITEMSET Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISOUTLINE
|
IMMQTNITEMENHWD-PURGCONFIGURABLEITEMNUMBER table field - Hierarchy Number
▼
Description: Hierarchy Number Field Name: PURGCONFIGURABLEITEMNUMBER Data Element: EXLIN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURGCONFIGURABLEITEMNUMBER
|
IMMQTNITEMENHWD-PURGDOCAGGRGDSUBITEMCATEGORY table field - Subitems Exist
▼
Description: Subitems Exist Field Name: PURGDOCAGGRGDSUBITEMCATEGORY Data Element: UPVOR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURGDOCAGGRGDSUBITEMCATEGORY
|
IMMQTNITEMENHWD-PURGEXTERNALSORTNUMBER table field - External Sort Number
▼
Description: External Sort Number Field Name: PURGEXTERNALSORTNUMBER Data Element: EXSNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURGEXTERNALSORTNUMBER
|