Details |
ICCMKTKEYFIG-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
ICCMKTKEYFIG-CHMLCMPLNCINFOUUID table field - Chemical Compliance Information
▼
Description: Chemical Compliance Information Field Name: CHMLCMPLNCINFOUUID Data Element: EHFND_CCI_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFOUUID
|
ICCMKTKEYFIG-NMBROFCHMLCMPLNCPCKGDPRODUCTS table field - Packaged Products
▼
Description: Packaged Products Field Name: NMBROFCHMLCMPLNCPCKGDPRODUCTS Data Element: EHPMA_NUMBER_OF_PP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCHMLCMPLNCPCKGDPRODUCTS
|
ICCMKTKEYFIG-NMBROFCHMLCMPLNCREQOPNWITHTOT table field - Pending Market Requests
▼
Description: Pending Market Requests Field Name: NMBROFCHMLCMPLNCREQOPNWITHTOT Data Element: EHPMA_NUMBER_OF_OPEN_REQ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCHMLCMPLNCREQOPNWITHTOT
|
ICCMKTKEYFIG-NMBROFCHMLCMPLNCMKTCOUNTRIES table field - Countries
▼
Description: Countries Field Name: NMBROFCHMLCMPLNCMKTCOUNTRIES Data Element: EHPMA_NUMBER_OF_COUNTRIES Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCHMLCMPLNCMKTCOUNTRIES
|
ICCMKTKEYFIG-NMBROFCHMLCMPLNCPROCDMKTCVRGS table field -
▼
Description: Field Name: NMBROFCHMLCMPLNCPROCDMKTCVRGS Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCHMLCMPLNCPROCDMKTCVRGS
|
ICCMKTKEYFIG-NMBROFCHMLCMPLNCREQREQD table field -
▼
Description: Field Name: NMBROFCHMLCMPLNCREQREQD Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCHMLCMPLNCREQREQD
|
ICCMKTKEYFIG-NMBROFCHMLCMPLNCREQOPN table field -
▼
Description: Field Name: NMBROFCHMLCMPLNCREQOPN Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCHMLCMPLNCREQOPN
|
ICCMKTKEYFIG-NMBROFCHMLCMPLNCREQPROCD table field - Covered Market Requests
▼
Description: Covered Market Requests Field Name: NMBROFCHMLCMPLNCREQPROCD Data Element: EHPMA_NUMBER_OF_COV_REQ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCHMLCMPLNCREQPROCD
|
ICCMKTKEYFIG-NMBROFCMPLRQRSLTS table field - Number of Compliance Requirement Results
▼
Description: Number of Compliance Requirement Results Field Name: NMBROFCMPLRQRSLTS Data Element: EHFND_CCI_NUMBER_OF_CRR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCMPLRQRSLTS
|
ICCMKTKEYFIG-NMBROFINPROCESSCMPLRQRSLTS table field - Number of Compliance Requirement Results 'In Progress'
▼
Description: Number of Compliance Requirement Results 'In Progress' Field Name: NMBROFINPROCESSCMPLRQRSLTS Data Element: EHFND_CCI_NUMBER_OF_CRR_IP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFINPROCESSCMPLRQRSLTS
|
ICCMKTKEYFIG-NMBROFRELEASEDCMPLRQRSLTS table field - Number of Released Compliance Requirement Results
▼
Description: Number of Released Compliance Requirement Results Field Name: NMBROFRELEASEDCMPLRQRSLTS Data Element: EHFND_CCI_NUMBER_OF_CRR_RE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFRELEASEDCMPLRQRSLTS
|
ICCMKTKEYFIG-RELEASEDCMPLRQRSLTSPCT table field -
▼
Description: Field Name: RELEASEDCMPLRQRSLTSPCT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RELEASEDCMPLRQRSLTSPCT
|
ICCMKTKEYFIG-INPROCESSCMPLRQRSLTSPCT table field -
▼
Description: Field Name: INPROCESSCMPLRQRSLTSPCT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INPROCESSCMPLRQRSLTSPCT
|
ICCMKTKEYFIG-RELEASEDCMPLRQRSLTSPCTNAME table field - Number of Released Compliance Requirement Results
▼
Description: Number of Released Compliance Requirement Results Field Name: RELEASEDCMPLRQRSLTSPCTNAME Data Element: EHFND_CCI_CRR_RE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RELEASEDCMPLRQRSLTSPCTNAME
|
ICCMKTKEYFIG-INPROCESSCMPLRQRSLTSPCTNAME table field - Number of Compliance Requirement Results 'In Progress'
▼
Description: Number of Compliance Requirement Results 'In Progress' Field Name: INPROCESSCMPLRQRSLTSPCTNAME Data Element: EHFND_CCI_CRR_IP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INPROCESSCMPLRQRSLTSPCTNAME
|
ICCMKTKEYFIG-PRODSTEWARDSHIPRESPUNIT table field - Responsible Unit
▼
Description: Responsible Unit Field Name: PRODSTEWARDSHIPRESPUNIT Data Element: EHFND_CCI_RESPONSIBLE_UNIT_PSS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODSTEWARDSHIPRESPUNIT
|
ICCMKTKEYFIG-MATERIALISSOLD table field - Product is Sold
▼
Description: Product is Sold Field Name: MATERIALISSOLD Data Element: EHFND_CCI_IS_SOLD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISSOLD
|
ICCMKTKEYFIG-MATERIALISTRANSPORTED table field - Product is Transported
▼
Description: Product is Transported Field Name: MATERIALISTRANSPORTED Data Element: EHFND_CCI_IS_TRANSPORTED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISTRANSPORTED
|
ICCMKTKEYFIG-MATERIALISSOURCED table field - Product is Sourced
▼
Description: Product is Sourced Field Name: MATERIALISSOURCED Data Element: EHFND_CCI_IS_SOURCED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISSOURCED
|
ICCMKTKEYFIG-MATERIALISPRODUCED table field - Product is Produced
▼
Description: Product is Produced Field Name: MATERIALISPRODUCED Data Element: EHFND_CCI_IS_PRODUCED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISPRODUCED
|
ICCMKTKEYFIG-MATERIALISDISPOSED table field - Product is Disposed
▼
Description: Product is Disposed Field Name: MATERIALISDISPOSED Data Element: EHFND_CCI_IS_DISPOSED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISDISPOSED
|
ICCMKTKEYFIG-MATERIALISEMISSIONRELEVANT table field - Product is Emission Relevant
▼
Description: Product is Emission Relevant Field Name: MATERIALISEMISSIONRELEVANT Data Element: EHFND_CCI_IS_EMISSION_RLVT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISEMISSIONRELEVANT
|