Details |
ICAGDATA-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
ICAGDATA-COLLATERALAGREEMENTUUID table field - GUID for Table CMS_CAG
▼
Description: GUID for Table CMS_CAG Field Name: COLLATERALAGREEMENTUUID Data Element: CMS_DTE_CAG_GUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLATERALAGREEMENTUUID
|
ICAGDATA-COLLATERALAGREEMENTID table field - Collateral Agreement ID
▼
Description: Collateral Agreement ID Field Name: COLLATERALAGREEMENTID Data Element: CMS_DTE_CAGID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: CMS_CAGID AppClass: SHLP: CMS_SRCH_CAG SHLP Field: CAGMTID ConvExit: See all SAP tables containing field COLLATERALAGREEMENTID
|
ICAGDATA-COLLATERALAGREEMENTTYPE table field - Collateral Agreement Type
▼
Description: Collateral Agreement Type Field Name: COLLATERALAGREEMENTTYPE Data Element: CMS_DTE_CAG_TYP Data Type: length (Dec): 0(0) Check table: TCMS_CAG_TYP Conversion Routine: Domain Name: MemoryID: CMS_CAG_TYP AppClass: SHLP: CMS_CAG_TYP SHLP Field: CAGMT_TYPE ConvExit: See all SAP tables containing field COLLATERALAGREEMENTTYPE
|
ICAGDATA-COLLATERALAGREEMENTNOMINALAMT table field - Nominal Value of the Collateral Agreement
▼
Description: Nominal Value of the Collateral Agreement Field Name: COLLATERALAGREEMENTNOMINALAMT Data Element: CMS_DTE_CAG_NOMINAL_VALUE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLATERALAGREEMENTNOMINALAMT
|
ICAGDATA-COLLATERALAGRMTNOMINALCRCY table field - Currency for Nominal Value of the Collateral Agreement
▼
Description: Currency for Nominal Value of the Collateral Agreement Field Name: COLLATERALAGRMTNOMINALCRCY Data Element: CMS_DTE_CAG_NOMINAL_CURR Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLATERALAGRMTNOMINALCRCY
|
ICAGDATA-COLLTRLAGRMTASSESSMENTAMT table field - Assessment Amount
▼
Description: Assessment Amount Field Name: COLLTRLAGRMTASSESSMENTAMT Data Element: CMS_DTE_CAG_ASMT_AMT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTASSESSMENTAMT
|
ICAGDATA-COLLTRLAGRMTASSESSMENTCRCY table field - Currency of Assessment Value
▼
Description: Currency of Assessment Value Field Name: COLLTRLAGRMTASSESSMENTCRCY Data Element: CMS_DTE_CAG_ASMT_CURR Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTASSESSMENTCRCY
|
ICAGDATA-COLLTRLAGRMTASSESSMENTDATE table field - Date on which the Assessment Value was Calculated
▼
Description: Date on which the Assessment Value was Calculated Field Name: COLLTRLAGRMTASSESSMENTDATE Data Element: CMS_DTE_CAG_ASMT_DATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTASSESSMENTDATE
|
ICAGDATA-COLLTRLAGREEMENTCONCLUDEDATE table field - Date on which Collateral Agreement was Concluded
▼
Description: Date on which Collateral Agreement was Concluded Field Name: COLLTRLAGREEMENTCONCLUDEDATE Data Element: CMS_DTE_CAG_DATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGREEMENTCONCLUDEDATE
|
ICAGDATA-COLLTRLAGREEMENTVALIDFROMDATE table field - Date
▼
Description: Date Field Name: COLLTRLAGREEMENTVALIDFROMDATE Data Element: CMS_DTE_DATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGREEMENTVALIDFROMDATE
|
ICAGDATA-COLLTRLAGREEMENTVALIDTODATE table field - Date
▼
Description: Date Field Name: COLLTRLAGREEMENTVALIDTODATE Data Element: CMS_DTE_DATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGREEMENTVALIDTODATE
|
ICAGDATA-COLLATERALADMINORGUNIT table field - Administration Organizational Unit
▼
Description: Administration Organizational Unit Field Name: COLLATERALADMINORGUNIT Data Element: CMS_DTE_ADMINORG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: CMS_ADMINORG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLATERALADMINORGUNIT
|
ICAGDATA-COLLATERALBANKAREA table field - Bank Area in Collateral Management
▼
Description: Bank Area in Collateral Management Field Name: COLLATERALBANKAREA Data Element: CMS_DTE_BANKAREA Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: CMS_BANKAREA AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLATERALBANKAREA
|
ICAGDATA-COLLTRLAGRMTJURISDICTIONCNTRY table field - Jurisdiction Country/Region
▼
Description: Jurisdiction Country/Region Field Name: COLLTRLAGRMTJURISDICTIONCNTRY Data Element: CMS_DTE_COUNTRY_KEY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTJURISDICTIONCNTRY
|
ICAGDATA-COLLATERALAGREEMENTISGLOBAL table field - Flag to indicate a Global Collateral Agreement
▼
Description: Flag to indicate a Global Collateral Agreement Field Name: COLLATERALAGREEMENTISGLOBAL Data Element: CMS_DTE_FLG_CAG_GLOBAL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLATERALAGREEMENTISGLOBAL
|
ICAGDATA-COLLTRLAGRMTSPCLMARKDWNPCT table field - Percentage of Special Markdown
▼
Description: Percentage of Special Markdown Field Name: COLLTRLAGRMTSPCLMARKDWNPCT Data Element: CMS_DTE_CAG_SPL_MARKDOWN_PCT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTSPCLMARKDWNPCT
|
ICAGDATA-COLLTRLAGRMTSPCLMARKDWNAMT table field - Amount of Special Markdown
▼
Description: Amount of Special Markdown Field Name: COLLTRLAGRMTSPCLMARKDWNAMT Data Element: CMS_DTE_CAG_SPL_MARKDOWN_AMT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTSPCLMARKDWNAMT
|
ICAGDATA-COLLTRLAGRMTSPCLMARKDOWNCRCY table field - Currency for Amount of Special Markdown
▼
Description: Currency for Amount of Special Markdown Field Name: COLLTRLAGRMTSPCLMARKDOWNCRCY Data Element: CMS_DTE_CAG_SPL_MRKDWN_CURR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTSPCLMARKDOWNCRCY
|
ICAGDATA-COLLATERALAGREEMENTDESCRIPTION table field - Description of Collateral Agreement
▼
Description: Description of Collateral Agreement Field Name: COLLATERALAGREEMENTDESCRIPTION Data Element: CMS_DTE_CAG_DESC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLATERALAGREEMENTDESCRIPTION
|
ICAGDATA-COLLTRLAGRMTRELEASEFREQUENCY table field - The unit for period of Release Frequency
▼
Description: The unit for period of Release Frequency Field Name: COLLTRLAGRMTRELEASEFREQUENCY Data Element: CMS_DTE_IND_CAG_REL_FREQ_UNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTRELEASEFREQUENCY
|
ICAGDATA-COLLTRLAGRMTRELEASEPERIOD table field - Period for Frequency of Release of Collateral Agreement
▼
Description: Period for Frequency of Release of Collateral Agreement Field Name: COLLTRLAGRMTRELEASEPERIOD Data Element: CMS_DTE_CAG_REL_FREQ_PERIOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTRELEASEPERIOD
|
ICAGDATA-COLLTRLAGRMTEXTREFNUMBER table field - External/Old Collateral Agreement ID
▼
Description: External/Old Collateral Agreement ID Field Name: COLLTRLAGRMTEXTREFNUMBER Data Element: CMS_DTE_OLD_CAGID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTEXTREFNUMBER
|
ICAGDATA-COLLTRLAGRMTMINQLTATVEXCPTN table field - Exceptions for Minimum Risk Weight
▼
Description: Exceptions for Minimum Risk Weight Field Name: COLLTRLAGRMTMINQLTATVEXCPTN Data Element: CMS_DTE_CAG_MIN_QUAL_EXCEP_TYP Data Type: length (Dec): 0(0) Check table: TCMS_CAG_MQEXP Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: CMS_CAG_MQETYP SHLP Field: MIN_QL_EXCEP_TYP ConvExit: See all SAP tables containing field COLLTRLAGRMTMINQLTATVEXCPTN
|
ICAGDATA-COLLTRLAGRMTMINQLTATVCRITRARSN table field - Reason for the Minimum Qualitative Criterion
▼
Description: Reason for the Minimum Qualitative Criterion Field Name: COLLTRLAGRMTMINQLTATVCRITRARSN Data Element: CMS_DTE_CAG_ATT_ID_TY_CAG001 Data Type: length (Dec): 0(0) Check table: TCMS_ATT_ID_TY Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTMINQLTATVCRITRARSN
|
ICAGDATA-COLLTRLAGRMTISMINQLTATVRQMTS table field - Flag:Minimum requirements fulfilled for CAG(for Basel II)
▼
Description: Flag:Minimum requirements fulfilled for CAG(for Basel II) Field Name: COLLTRLAGRMTISMINQLTATVRQMTS Data Element: CMS_DTE_FLG_CAG_MIN_QUAL_REQMT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTISMINQLTATVRQMTS
|
ICAGDATA-COLLTRLAGRMTMINQLTATVCRITERIA table field - MInimum Qualitative Criterion
▼
Description: MInimum Qualitative Criterion Field Name: COLLTRLAGRMTMINQLTATVCRITERIA Data Element: CMS_DTE_CAG_MIN_QUAL_CRITERION Data Type: length (Dec): 0(0) Check table: TCMS_CAG_MQCRT Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: CMS_CAG_MQCRT SHLP Field: MIN_QL_CRITERION ConvExit: See all SAP tables containing field COLLTRLAGRMTMINQLTATVCRITERIA
|
ICAGDATA-COLLATERALAGREEMENTASSETPCT table field - Percentage of the Asset Value used in Collateral Agreement
▼
Description: Percentage of the Asset Value used in Collateral Agreement Field Name: COLLATERALAGREEMENTASSETPCT Data Element: CMS_DTE_PCT_AST_VAL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLATERALAGREEMENTASSETPCT
|
ICAGDATA-COLLTRLAGRMTTERMNRIGHTTYPE table field - Termination Right Type
▼
Description: Termination Right Type Field Name: COLLTRLAGRMTTERMNRIGHTTYPE Data Element: CMS_DTE_TERM_RIGHT_TYP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: CMS_CAG_TRTYP SHLP Field: TERM_RIGHT_TYP ConvExit: See all SAP tables containing field COLLTRLAGRMTTERMNRIGHTTYPE
|
ICAGDATA-COLLTRLAGRMTTERMNFREQUENCY table field - The Unit for Period of Termination Frequency
▼
Description: The Unit for Period of Termination Frequency Field Name: COLLTRLAGRMTTERMNFREQUENCY Data Element: CMS_DTE_IND_CAG_TERM_FREQ_UNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTTERMNFREQUENCY
|
ICAGDATA-COLLTRLAGRMTTERMNPERIOD table field - Period for Frequency of Termination of Collateral Agreement
▼
Description: Period for Frequency of Termination of Collateral Agreement Field Name: COLLTRLAGRMTTERMNPERIOD Data Element: CMS_DTE_CAG_TERM_FREQ_PERIOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTTERMNPERIOD
|
ICAGDATA-COLLTRLAGRMTTERMNNOTICEFRQCY table field - The Unit for the Termination Notice Period
▼
Description: The Unit for the Termination Notice Period Field Name: COLLTRLAGRMTTERMNNOTICEFRQCY Data Element: CMS_DTE_IND_CAG_NOTICE_UNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTTERMNNOTICEFRQCY
|
ICAGDATA-COLLTRLAGRMTTERMNNOTICEPERIOD table field - Notice Period Required to Terminate Collateral Agreement
▼
Description: Notice Period Required to Terminate Collateral Agreement Field Name: COLLTRLAGRMTTERMNNOTICEPERIOD Data Element: CMS_DTE_CAG_NOTICE_PERIOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTTERMNNOTICEPERIOD
|
ICAGDATA-COLLTRLAGRMTTERMNNOTICEDATE table field - Date on which Termination Notice was Sent
▼
Description: Date on which Termination Notice was Sent Field Name: COLLTRLAGRMTTERMNNOTICEDATE Data Element: CMS_DTE_CAG_TERM_NOTICE_DATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTTERMNNOTICEDATE
|
ICAGDATA-COLLTRLAGRMTTERMINATIONREASON table field - Termination Type
▼
Description: Termination Type Field Name: COLLTRLAGRMTTERMINATIONREASON Data Element: CMS_DTE_CAG_ATT_ID_TY_CAG002 Data Type: length (Dec): 0(0) Check table: TCMS_ATT_ID_TY Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTTERMINATIONREASON
|
ICAGDATA-COLLTRLAGRMTTERMNGUARAMT table field - Amount of Guarantee in the event of Termination
▼
Description: Amount of Guarantee in the event of Termination Field Name: COLLTRLAGRMTTERMNGUARAMT Data Element: CMS_DTE_CAG_TERM_VALUE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTTERMNGUARAMT
|
ICAGDATA-COLLTRLAGRMTTERMNGUARCRCY table field - Currency for Amount of Guarantee in the event of Termination
▼
Description: Currency for Amount of Guarantee in the event of Termination Field Name: COLLTRLAGRMTTERMNGUARCRCY Data Element: CMS_DTE_CAG_TERM_VALUE_CURR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTTERMNGUARCRCY
|
ICAGDATA-COLLTRLAGRMTGUARANTEEPCT table field - Guarantee Rate
▼
Description: Guarantee Rate Field Name: COLLTRLAGRMTGUARANTEEPCT Data Element: CMS_DTE_CAG_GUAR_RATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARANTEEPCT
|
ICAGDATA-COLLTRLAGRMTHASCOUNTERGUAR table field - Flag for Counter Guarantee
▼
Description: Flag for Counter Guarantee Field Name: COLLTRLAGRMTHASCOUNTERGUAR Data Element: CMS_DTE_FLG_CAG_CNTR_GUAR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTHASCOUNTERGUAR
|
ICAGDATA-COLLTRLAGRMTHASADDITIONALGUAR table field - Flag for Co-guarantee
▼
Description: Flag for Co-guarantee Field Name: COLLTRLAGRMTHASADDITIONALGUAR Data Element: CMS_DTE_FLG_CAG_CO_GUAR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTHASADDITIONALGUAR
|
ICAGDATA-COLLTRLAGRMTGUARISFXDLIABILITY table field - Flag for Fixed Liability
▼
Description: Flag for Fixed Liability Field Name: COLLTRLAGRMTGUARISFXDLIABILITY Data Element: CMS_DTE_FLG_CAG_FIXED_LIABILTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARISFXDLIABILITY
|
ICAGDATA-COLLTRLAGRMTGUARISDFLTLBLTY table field - Flag for Default Liability
▼
Description: Flag for Default Liability Field Name: COLLTRLAGRMTGUARISDFLTLBLTY Data Element: CMS_DTE_FLG_CAG_DEF_LIABILITY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARISDFLTLBLTY
|
ICAGDATA-COLLTRLAGRMTGUARDFLTLBLTYPCT table field - Default Liability in %
▼
Description: Default Liability in % Field Name: COLLTRLAGRMTGUARDFLTLBLTYPCT Data Element: CMS_DTE_FLG_CAG_PCT_DEF_LIABTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARDFLTLBLTYPCT
|
ICAGDATA-COLLTRLAGRMTGUARLINKINCALC table field - Flag for back-up guarantee to be used in calculations or not
▼
Description: Flag for back-up guarantee to be used in calculations or not Field Name: COLLTRLAGRMTGUARLINKINCALC Data Element: CMS_DTE_FLG_CAG_INCL_LINKED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARLINKINCALC
|
ICAGDATA-COLLTRLAGRMTGUARAUTHAPPROVAL table field - Approval from authorities
▼
Description: Approval from authorities Field Name: COLLTRLAGRMTGUARAUTHAPPROVAL Data Element: CMS_DTE_IND_CAG_APPR_AUTH Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARAUTHAPPROVAL
|
ICAGDATA-COLLTRLAGRMTGUARISENFORCEABLE table field - Agreement directly enforceable
▼
Description: Agreement directly enforceable Field Name: COLLTRLAGRMTGUARISENFORCEABLE Data Element: CMS_DTE_FLG_CAG_ENFORCEABLE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARISENFORCEABLE
|
ICAGDATA-COLLTRLAGRMTGUARLENDINGRATE table field - Lending Rate of a Guarantee
▼
Description: Lending Rate of a Guarantee Field Name: COLLTRLAGRMTGUARLENDINGRATE Data Element: CMS_DTE_CAG_LRTE_PCT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARLENDINGRATE
|
ICAGDATA-COLLTRLAGRMTGUARREDUCNFRQCY table field - Unit for Period of Frequency for Reduction in Guarantee Valu
▼
Description: Unit for Period of Frequency for Reduction in Guarantee Valu Field Name: COLLTRLAGRMTGUARREDUCNFRQCY Data Element: CMS_DTE_IND_CAG_RED_FREQ_UNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARREDUCNFRQCY
|
ICAGDATA-COLLTRLAGRMTGUARREDUCNPERIOD table field - Period for Frequency of Reduction in Value of Guarantee
▼
Description: Period for Frequency of Reduction in Value of Guarantee Field Name: COLLTRLAGRMTGUARREDUCNPERIOD Data Element: CMS_DTE_CAG_RED_FREQ_PERIOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARREDUCNPERIOD
|
ICAGDATA-COLLTRLAGRMTGUARREDUCNAMT table field - Reduction in Amount of Guarantee
▼
Description: Reduction in Amount of Guarantee Field Name: COLLTRLAGRMTGUARREDUCNAMT Data Element: CMS_DTE_CAG_REDU_AMT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARREDUCNAMT
|
ICAGDATA-COLLTRLAGRMTGUARREDUCNCRCY table field - Currency of the Reduced Amount of the Guarantee
▼
Description: Currency of the Reduced Amount of the Guarantee Field Name: COLLTRLAGRMTGUARREDUCNCRCY Data Element: CMS_DTE_CAG_REDU_AMT_CURR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARREDUCNCRCY
|
ICAGDATA-COLLTRLAGRMTGUARREDUCNPCT table field - Percentage of Reduction in the Value of a Guarantee
▼
Description: Percentage of Reduction in the Value of a Guarantee Field Name: COLLTRLAGRMTGUARREDUCNPCT Data Element: CMS_DTE_CAG_REDU_PCT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTGUARREDUCNPCT
|
ICAGDATA-COLLTRLAGRMTORIGINALAMOUNT table field - Original Protection of the Agreements
▼
Description: Original Protection of the Agreements Field Name: COLLTRLAGRMTORIGINALAMOUNT Data Element: CMS_DTE_CAG_ORIGINAL_VALUE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTORIGINALAMOUNT
|
ICAGDATA-COLLTRLAGRMTORIGINALCURRENCY table field - Currency of the Original Protection Value
▼
Description: Currency of the Original Protection Value Field Name: COLLTRLAGRMTORIGINALCURRENCY Data Element: CMS_DTE_ORI_VALUE_CURR Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTORIGINALCURRENCY
|
ICAGDATA-COLLTRLAGRMTTRANSFISLEASING table field - Flag: Transfer is part of a leasing transaction
▼
Description: Flag: Transfer is part of a leasing transaction Field Name: COLLTRLAGRMTTRANSFISLEASING Data Element: CMS_DTE_FLG_CAG_LEASING_TXN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTTRANSFISLEASING
|
ICAGDATA-COLLTRLAGRMTTRANSFLESSORLIEN table field - Indicator for Lessor Lien on Collateral Agreement
▼
Description: Indicator for Lessor Lien on Collateral Agreement Field Name: COLLTRLAGRMTTRANSFLESSORLIEN Data Element: CMS_DTE_IND_CAG_LESSOR_LIEN Data Type: length (Dec): 0(0) Check table: TCMS_CAG_LSRLN Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTTRANSFLESSORLIEN
|
ICAGDATA-COLLTRLAGRMTTRANSFACCSRYLBLTY table field - Specifies the applicability of accessories liability
▼
Description: Specifies the applicability of accessories liability Field Name: COLLTRLAGRMTTRANSFACCSRYLBLTY Data Element: CMS_DTE_IND_CAG_ACC_LIABLE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTTRANSFACCSRYLBLTY
|
ICAGDATA-COLLTRLAGRMTACCTRBLASSGMT table field - Flag for Assignment of Accounts Receivables(AR) from Sale
▼
Description: Flag for Assignment of Accounts Receivables(AR) from Sale Field Name: COLLTRLAGRMTACCTRBLASSGMT Data Element: CMS_DTE_FLG_CAG_AR_FRM_SALE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTACCTRBLASSGMT
|
ICAGDATA-COLLTRLAGRMTMINSTOCKAMOUNT table field - Minimum stock Amount agreed in the Collateral Agreement
▼
Description: Minimum stock Amount agreed in the Collateral Agreement Field Name: COLLTRLAGRMTMINSTOCKAMOUNT Data Element: CMS_DTE_CAG_MIN_STOCK_AMT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTMINSTOCKAMOUNT
|
ICAGDATA-COLLTRLAGRMTMINSTOCKCURRENCY table field - Currency of the Minimum Stock Amount
▼
Description: Currency of the Minimum Stock Amount Field Name: COLLTRLAGRMTMINSTOCKCURRENCY Data Element: CMS_DTE_CAG_MIN_STOCK_AMT_CURR Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTMINSTOCKCURRENCY
|
ICAGDATA-COLLTRLAGRMTHASADDITIONALRBL table field - Flag for Additional receivable
▼
Description: Flag for Additional receivable Field Name: COLLTRLAGRMTHASADDITIONALRBL Data Element: CMS_DTE_FLG_CAG_ADDNL_RBL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTHASADDITIONALRBL
|
ICAGDATA-COLLTRLAGRMTADDITIONALRBLDATE table field - Date on which Additional Receivable was Accepted
▼
Description: Date on which Additional Receivable was Accepted Field Name: COLLTRLAGRMTADDITIONALRBLDATE Data Element: CMS_DTE_CAG_DATE_ADDNL_RBL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTADDITIONALRBLDATE
|
ICAGDATA-AGRMTGENBUSCNDNLIENWVR table field - GBC Lien on Agreement
▼
Description: GBC Lien on Agreement Field Name: AGRMTGENBUSCNDNLIENWVR Data Element: CMS_DTE_IND_CAG_GBC_LIEN Data Type: length (Dec): 0(0) Check table: TCMS_CAG_GBCLN Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTGENBUSCNDNLIENWVR
|
ICAGDATA-COLLTRLAGRMTPLEDGEISDISCLOSED table field - Flag to indicator whether the Agreement is disclosed or not
▼
Description: Flag to indicator whether the Agreement is disclosed or not Field Name: COLLTRLAGRMTPLEDGEISDISCLOSED Data Element: CMS_DTE_FLG_CAG_DISCL_PLEDGE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTPLEDGEISDISCLOSED
|
ICAGDATA-COLLTRLAGRMTPLEDGEDISCLOSEDDTE table field - Date of Disclosure to Third-party Debtor
▼
Description: Date of Disclosure to Third-party Debtor Field Name: COLLTRLAGRMTPLEDGEDISCLOSEDDTE Data Element: CMS_DTE_CAG_DISCL_DATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTPLEDGEDISCLOSEDDTE
|
ICAGDATA-COLLTRLAGRMTASSIGNMENTREASON table field - Reason for Assignment
▼
Description: Reason for Assignment Field Name: COLLTRLAGRMTASSIGNMENTREASON Data Element: CMS_DTE_CAG_ATT_ID_TY_CAG006 Data Type: length (Dec): 0(0) Check table: TCMS_ATT_ID_TY Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTASSIGNMENTREASON
|
ICAGDATA-AGRMTLANDCHRGINTERESTRATE table field - Land Charge Interest Rate
▼
Description: Land Charge Interest Rate Field Name: AGRMTLANDCHRGINTERESTRATE Data Element: CMS_DTE_CAG_LCHG_INT_RATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGINTERESTRATE
|
ICAGDATA-AGRMTLANDCHRGINCIDENTALPAYTPCT table field - Incidental Payments in Percentage
▼
Description: Incidental Payments in Percentage Field Name: AGRMTLANDCHRGINCIDENTALPAYTPCT Data Element: CMS_DTE_CAG_LCHG_INCD_PAYMT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGINCIDENTALPAYTPCT
|
ICAGDATA-AGRMTLANDCHRGPAYTFRQCY table field - The unit for period of payment frequency
▼
Description: The unit for period of payment frequency Field Name: AGRMTLANDCHRGPAYTFRQCY Data Element: CMS_DTE_IND_CAG_PYMT_FREQ_UNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGPAYTFRQCY
|
ICAGDATA-AGRMTLANDCHRGPAYTPERIOD table field - Period for Frequency of Payment of Land Charge Interest
▼
Description: Period for Frequency of Payment of Land Charge Interest Field Name: AGRMTLANDCHRGPAYTPERIOD Data Element: CMS_DTE_CAG_PYMT_FREQ_PERIOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGPAYTPERIOD
|
ICAGDATA-AGRMTLANDCHRGCALCSTRTDATE table field - Start Date for Land Charge Interest Calculation
▼
Description: Start Date for Land Charge Interest Calculation Field Name: AGRMTLANDCHRGCALCSTRTDATE Data Element: CMS_DTE_CAG_LCHG_INT_START_DAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGCALCSTRTDATE
|
ICAGDATA-AGRMTLANDCHRGINTRSTCAPITALYRS table field - Number of Years the Land Charge Interest can be Capitalized
▼
Description: Number of Years the Land Charge Interest can be Capitalized Field Name: AGRMTLANDCHRGINTRSTCAPITALYRS Data Element: CMS_DTE_CAG_LCHG_INT_YR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGINTRSTCAPITALYRS
|
ICAGDATA-AGRMTLANDCHRGENFORCEMENTTYPE table field - Enforcement Type
▼
Description: Enforcement Type Field Name: AGRMTLANDCHRGENFORCEMENTTYPE Data Element: CMS_DTE_IND_CAG_LCHG_ENFC_TYP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGENFORCEMENTTYPE
|
ICAGDATA-AGRMTLANDCHRGENFORCEMENTAMT table field - Enforcement Amount
▼
Description: Enforcement Amount Field Name: AGRMTLANDCHRGENFORCEMENTAMT Data Element: CMS_DTE_CAG_LCHG_ENFC_AMT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGENFORCEMENTAMT
|
ICAGDATA-AGRMTLANDCHRGENFORCEMENTCRCY table field - Currency for Enforcement Amount of Land Charge
▼
Description: Currency for Enforcement Amount of Land Charge Field Name: AGRMTLANDCHRGENFORCEMENTCRCY Data Element: CMS_DTE_CAG_LCHG_ENFC_AMT_CURR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGENFORCEMENTCRCY
|
ICAGDATA-AGRMTLANDCHRGREFENFORCEMENTAMT table field - Reference amount for part (Equal,Secondar) enforcebility
▼
Description: Reference amount for part (Equal,Secondar) enforcebility Field Name: AGRMTLANDCHRGREFENFORCEMENTAMT Data Element: CMS_DTE_CAG_LCHG_ENFC_REF_AMT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGREFENFORCEMENTAMT
|
ICAGDATA-AGRMTLANDCHRGENFRCMNTTTLTYPE table field - Indicator for Enforcement Title
▼
Description: Indicator for Enforcement Title Field Name: AGRMTLANDCHRGENFRCMNTTTLTYPE Data Element: CMS_DTE_IND_CAG_LCHG_ENFC_TITL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGENFRCMNTTTLTYPE
|
ICAGDATA-COLAGRHTBLRGINTRSTPAYFRQUNIT table field - Unit for period of Payment Frequency of HBR interest
▼
Description: Unit for period of Payment Frequency of HBR interest Field Name: COLAGRHTBLRGINTRSTPAYFRQUNIT Data Element: CMS_DTE_IND_CAG_HBR_INT_UNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLAGRHTBLRGINTRSTPAYFRQUNIT
|
ICAGDATA-COLAGRHTBLRGINTRSTPAYFRQPERD table field - Payment Frequency Period for HBR interest
▼
Description: Payment Frequency Period for HBR interest Field Name: COLAGRHTBLRGINTRSTPAYFRQPERD Data Element: CMS_DTE_CAG_HBR_INT_PERIOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLAGRHTBLRGINTRSTPAYFRQPERD
|
ICAGDATA-COLAGRHTBLRGISINTRSTINCREASING table field - Flag for increase in HBR interest
▼
Description: Flag for increase in HBR interest Field Name: COLAGRHTBLRGISINTRSTINCREASING Data Element: CMS_DTE_FLG_LCHG_INC_INT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLAGRHTBLRGISINTRSTINCREASING
|
ICAGDATA-COLAGRHTBLRGINTINCFRQUNIT table field - Unit for Frequency Period of Increase in HBR Interest
▼
Description: Unit for Frequency Period of Increase in HBR Interest Field Name: COLAGRHTBLRGINTINCFRQUNIT Data Element: CMS_DTE_IND_CAG_HBR_INC_UNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLAGRHTBLRGINTINCFRQUNIT
|
ICAGDATA-COLAGRHTBLRGINTINCFRQPERD table field - Frequency Period for Increase in HBR Interest
▼
Description: Frequency Period for Increase in HBR Interest Field Name: COLAGRHTBLRGINTINCFRQPERD Data Element: CMS_DTE_CAG_HBR_INC_PERIOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLAGRHTBLRGINTINCFRQPERD
|
ICAGDATA-COLAGRHTBLRGINCREASEPCT table field - Percentage Increase in Heritable Building Rights Amount
▼
Description: Percentage Increase in Heritable Building Rights Amount Field Name: COLAGRHTBLRGINCREASEPCT Data Element: CMS_DTE_CAG_LCHG_INC_PCT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLAGRHTBLRGINCREASEPCT
|
ICAGDATA-COLAGRHTBLRGINCREASEAMT table field - Increase in Heritable Building Rights Amount
▼
Description: Increase in Heritable Building Rights Amount Field Name: COLAGRHTBLRGINCREASEAMT Data Element: CMS_DTE_CAG_LCHG_INC_AMT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLAGRHTBLRGINCREASEAMT
|
ICAGDATA-COLAGRHTBLRGINCREASECRCY table field - Currency for Increase in HBR amount
▼
Description: Currency for Increase in HBR amount Field Name: COLAGRHTBLRGINCREASECRCY Data Element: CMS_DTE_CAG_LCHG_INC_AMT_CURR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLAGRHTBLRGINCREASECRCY
|
ICAGDATA-COLAGRHTBLRGINTRSTINCRSTARTDTE table field - Start date for Increase in Heritable Building Right Interest
▼
Description: Start date for Increase in Heritable Building Right Interest Field Name: COLAGRHTBLRGINTRSTINCRSTARTDTE Data Element: CMS_DTE_CAG_LCHG_INC_START_DAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLAGRHTBLRGINTRSTINCRSTARTDTE
|
ICAGDATA-COLAGRHTBLRGENFRCMNTWVR table field - Indicator for Waiver of HBR Enforcement
▼
Description: Indicator for Waiver of HBR Enforcement Field Name: COLAGRHTBLRGENFRCMNTWVR Data Element: CMS_DTE_IND_CAG_LCHG_HBR_WAIVE Data Type: length (Dec): 0(0) Check table: TCMS_CAG_HBRWV Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLAGRHTBLRGENFRCMNTWVR
|
ICAGDATA-COLAGRHTBLRGINTRSTINCRLASTDTE table field - Last date of Increase in Heritable Building Right Interest
▼
Description: Last date of Increase in Heritable Building Right Interest Field Name: COLAGRHTBLRGINTRSTINCRLASTDTE Data Element: CMS_DTE_CAG_LCHG_INC_LAST_DATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLAGRHTBLRGINTRSTINCRLASTDTE
|
ICAGDATA-AGRMTLANDCHRGISCOLLECTIVE table field - Flag: Collective Land Charge
▼
Description: Flag: Collective Land Charge Field Name: AGRMTLANDCHRGISCOLLECTIVE Data Element: CMS_DTE_FLG_CAG_LCHG_COLL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGISCOLLECTIVE
|
ICAGDATA-AGRMTLANDCHRGHASCERT table field - Flag: Land Charge certificate exists
▼
Description: Flag: Land Charge certificate exists Field Name: AGRMTLANDCHRGHASCERT Data Element: CMS_DTE_FLG_CAG_LCHG_CERT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGHASCERT
|
ICAGDATA-AGRMTLANDCHRGCERTNUMBER table field - Charge Certificate Number
▼
Description: Charge Certificate Number Field Name: AGRMTLANDCHRGCERTNUMBER Data Element: CMS_DTE_CAG_LCHG_CERT_NUM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGCERTNUMBER
|
ICAGDATA-AGRMTLANDCHRGFILENUMBER table field - File Number
▼
Description: File Number Field Name: AGRMTLANDCHRGFILENUMBER Data Element: CMS_DTE_CAG_LCHG_FILE_NUM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AGRMTLANDCHRGFILENUMBER
|
ICAGDATA-COLLTRLAGRMTCREDITINSURCOVER table field - Scope of Cover of Credit Insurance
▼
Description: Scope of Cover of Credit Insurance Field Name: COLLTRLAGRMTCREDITINSURCOVER Data Element: CMS_DTE_CAG_ATT_ID_TY_CAG004 Data Type: length (Dec): 0(0) Check table: TCMS_ATT_ID_TY Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTCREDITINSURCOVER
|
ICAGDATA-COLLTRLAGRMTUNIT1 table field - Organizational Unit 1: Collateral Agreement
▼
Description: Organizational Unit 1: Collateral Agreement Field Name: COLLTRLAGRMTUNIT1 Data Element: CMS_DTE_CAG_ORG_UNIT1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTUNIT1
|
ICAGDATA-COLLTRLAGRMTUNIT2 table field - Organizational Unit 2: Collateral Agreement
▼
Description: Organizational Unit 2: Collateral Agreement Field Name: COLLTRLAGRMTUNIT2 Data Element: CMS_DTE_CAG_ORG_UNIT2 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTUNIT2
|
ICAGDATA-COLLTRLAGRMTUNIT3 table field - Organizational Unit 3: Collateral Agreement
▼
Description: Organizational Unit 3: Collateral Agreement Field Name: COLLTRLAGRMTUNIT3 Data Element: CMS_DTE_CAG_ORG_UNIT3 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTUNIT3
|
ICAGDATA-COLLTRLAGRMTUNIT4 table field - Organizational Unit 4: Collateral Agreement
▼
Description: Organizational Unit 4: Collateral Agreement Field Name: COLLTRLAGRMTUNIT4 Data Element: CMS_DTE_CAG_ORG_UNIT4 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTUNIT4
|
ICAGDATA-COLLTRLAGRMTUNIT5 table field - Organizational Unit 5: Collateral Agreement
▼
Description: Organizational Unit 5: Collateral Agreement Field Name: COLLTRLAGRMTUNIT5 Data Element: CMS_DTE_CAG_ORG_UNIT5 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTUNIT5
|
ICAGDATA-COLLTRLAGRMTLIQUIDATIONMODE table field - Mode of Liquidation decision for the pool agreement
▼
Description: Mode of Liquidation decision for the pool agreement Field Name: COLLTRLAGRMTLIQUIDATIONMODE Data Element: CMS_DTE_LIQD_MODE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTLIQUIDATIONMODE
|
ICAGDATA-COLLTRLAGRMTCORRESPNCROLE table field - Correspondence role
▼
Description: Correspondence role Field Name: COLLTRLAGRMTCORRESPNCROLE Data Element: CMS_DTE_COR_ROLE Data Type: length (Dec): 0(0) Check table: TFK070M Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTCORRESPNCROLE
|
ICAGDATA-COLLTRLAGRMTPOOLRELTHRESHOLD table field - Limit above which the Collaterals can be Released from Pool
▼
Description: Limit above which the Collaterals can be Released from Pool Field Name: COLLTRLAGRMTPOOLRELTHRESHOLD Data Element: CMS_DTE_CAG_RELEASE_THRESHOLD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COLLTRLAGRMTPOOLRELTHRESHOLD
|