Details |
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-PAYEE table field -
▼
Description: Field Name: PAYEE Data Element: HRAU_ATO_PAYEVNTEMPPAYEE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYEE
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-IDENTIFIERS table field -
▼
Description: Field Name: IDENTIFIERS Data Element: HRAU_ATO_PAYEVNTEMPIDENTIFIERS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field IDENTIFIERS
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-TAX_FILE_NUMBER_ID table field - Business Definition: A unique number issued by the Tax Offic
▼
Description: Business Definition: A unique number issued by the Tax Offic Field Name: TAX_FILE_NUMBER_ID Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAX_FILE_NUMBER_ID
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-AUSTRALIAN_BUSINESS_NUMBER_ID table field - Business Definition: A unique public identifier issued to al
▼
Description: Business Definition: A unique public identifier issued to al Field Name: AUSTRALIAN_BUSINESS_NUMBER_ID Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AUSTRALIAN_BUSINESS_NUMBER_ID
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-EMPLOYMENT_PAYROLL_NUMBER_ID table field - Business Definition: Number allocated by the payer payroll s
▼
Description: Business Definition: Number allocated by the payer payroll s Field Name: EMPLOYMENT_PAYROLL_NUMBER_ID Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EMPLOYMENT_PAYROLL_NUMBER_ID
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-PERSON_NAME_DETAILS table field -
▼
Description: Field Name: PERSON_NAME_DETAILS Data Element: HRAU_ATO_PAYEVNTEMPPERSON_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERSON_NAME_DETAILS
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-FAMILY_NAME_T table field - Business Definition: The person's last name or surname. The
▼
Description: Business Definition: The person's last name or surname. The Field Name: FAMILY_NAME_T Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FAMILY_NAME_T
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-GIVEN_NAME_T table field - Business Definition: The name given to a person which is tha
▼
Description: Business Definition: The name given to a person which is tha Field Name: GIVEN_NAME_T Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GIVEN_NAME_T
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-OTHER_GIVEN_NAME_T table field - Business Definition: The middle name given to a person which
▼
Description: Business Definition: The middle name given to a person which Field Name: OTHER_GIVEN_NAME_T Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OTHER_GIVEN_NAME_T
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-PERSON_DEMOGRAPHIC_DETAILS table field -
▼
Description: Field Name: PERSON_DEMOGRAPHIC_DETAILS Data Element: HRAU_ATO_PAYEVNTEMPPERSON_DEMO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERSON_DEMOGRAPHIC_DETAILS
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-BIRTH_DM table field - Business Definition: The date of the day in the month in whi
▼
Description: Business Definition: The date of the day in the month in whi Field Name: BIRTH_DM Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BIRTH_DM
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-BIRTH_M table field - Business Definition: The month in which an individual was bo
▼
Description: Business Definition: The month in which an individual was bo Field Name: BIRTH_M Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BIRTH_M
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-BIRTH_Y table field - Business Definition: The year in which an individual was bor
▼
Description: Business Definition: The year in which an individual was bor Field Name: BIRTH_Y Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BIRTH_Y
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-ADDRESS_DETAILS table field -
▼
Description: Field Name: ADDRESS_DETAILS Data Element: HRAU_ATO_PAYEVNTEMPADDRESS_DET Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADDRESS_DETAILS
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-LINE1T table field - Business Definition: First line utilising free format, that
▼
Description: Business Definition: First line utilising free format, that Field Name: LINE1T Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LINE1T
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-LINE2T table field - Business Definition: Second line utilising free format, that
▼
Description: Business Definition: Second line utilising free format, that Field Name: LINE2T Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LINE2T
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-LOCALITY_NAME_T table field - Business Definition: A word or combination of words, by whic
▼
Description: Business Definition: A word or combination of words, by whic Field Name: LOCALITY_NAME_T Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LOCALITY_NAME_T
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-STATE_OR_TERRITORY_C table field - Business Definition: The code that is assigned to each Austr
▼
Description: Business Definition: The code that is assigned to each Austr Field Name: STATE_OR_TERRITORY_C Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STATE_OR_TERRITORY_C
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-POSTCODE_T table field - Business Definition: The Australian descriptor for a postal
▼
Description: Business Definition: The Australian descriptor for a postal Field Name: POSTCODE_T Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field POSTCODE_T
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-COUNTRY_C table field - Business Definition: This represents the Country Code as pre
▼
Description: Business Definition: This represents the Country Code as pre Field Name: COUNTRY_C Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COUNTRY_C
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-ELECTRONIC_CONTACT table field -
▼
Description: Field Name: ELECTRONIC_CONTACT Data Element: HRAU_ATO_PAYEVNTEMPELECTRONIC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ELECTRONIC_CONTACT
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-ELECTRONIC_MAIL_ADDRESS_T table field - Business Definition: Denotes the address of an electronic ma
▼
Description: Business Definition: Denotes the address of an electronic ma Field Name: ELECTRONIC_MAIL_ADDRESS_T Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ELECTRONIC_MAIL_ADDRESS_T
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-TELEPHONE_MINIMAL_N table field - Business Definition: The number that is associated to a uniq
▼
Description: Business Definition: The number that is associated to a uniq Field Name: TELEPHONE_MINIMAL_N Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TELEPHONE_MINIMAL_N
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-EMPLOYER_CONDITIONS table field -
▼
Description: Field Name: EMPLOYER_CONDITIONS Data Element: HRAU_ATO_PAYEVNTEMPEMPLOYER_CO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EMPLOYER_CONDITIONS
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-EMPLOYMENT_START_D table field - XSD Date: yyyy-mm-dd [ext.]
▼
Description: XSD Date: yyyy-mm-dd [ext.] Field Name: EMPLOYMENT_START_D Data Element: XSDDATE_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EMPLOYMENT_START_D
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-EMPLOYMENT_END_D table field - XSD Date: yyyy-mm-dd [ext.]
▼
Description: XSD Date: yyyy-mm-dd [ext.] Field Name: EMPLOYMENT_END_D Data Element: XSDDATE_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EMPLOYMENT_END_D
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-REMUNERATION_INCOME_TAX_PAY_AS table field -
▼
Description: Field Name: REMUNERATION_INCOME_TAX_PAY_AS Data Element: HRAU_ATO_PAYEVNTEMPREMUNERATIO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REMUNERATION_INCOME_TAX_PAY_AS
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-PAYROLL_PERIOD table field -
▼
Description: Field Name: PAYROLL_PERIOD Data Element: HRAU_ATO_PAYEVNTEMPPAYROLL_PER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYROLL_PERIOD
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-START_D table field - XSD Date: yyyy-mm-dd [ext.]
▼
Description: XSD Date: yyyy-mm-dd [ext.] Field Name: START_D Data Element: XSDDATE_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field START_D
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-END_D table field - XSD Date: yyyy-mm-dd [ext.]
▼
Description: XSD Date: yyyy-mm-dd [ext.] Field Name: END_D Data Element: XSDDATE_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field END_D
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-PAYROLL_EVENT_FINAL_I table field - XSD Truth Value: True/False [ext.]
▼
Description: XSD Truth Value: True/False [ext.] Field Name: PAYROLL_EVENT_FINAL_I Data Element: XSDBOOLEAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYROLL_EVENT_FINAL_I
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-INDIVIDUAL_NON_BUSINESS table field -
▼
Description: Field Name: INDIVIDUAL_NON_BUSINESS Data Element: HRAU_ATO_PAYEVNTEMPINDIVIDUAL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INDIVIDUAL_NON_BUSINESS
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-GROSS_A table field - Business Definition: The total of all gross payments made to
▼
Description: Business Definition: The total of all gross payments made to Field Name: GROSS_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GROSS_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-COMMUNITY_DEVELOPMENT_EMPLOYME table field - Business Guidance: A CDEP payment is one of the following:-
▼
Description: Business Guidance: A CDEP payment is one of the following:- Field Name: COMMUNITY_DEVELOPMENT_EMPLOYME Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMUNITY_DEVELOPMENT_EMPLOYME
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-TAX_WITHHELD_A table field - Business Definition: This is the value, during the relevant
▼
Description: Business Definition: This is the value, during the relevant Field Name: TAX_WITHHELD_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAX_WITHHELD_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-EXEMPT_FOREIGN_EMPLOYMENT_INCO table field - Business Definition: The amount of foreign employment income
▼
Description: Business Definition: The amount of foreign employment income Field Name: EXEMPT_FOREIGN_EMPLOYMENT_INCO Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXEMPT_FOREIGN_EMPLOYMENT_INCO
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-VOLUNTARY_AGREEMENT table field -
▼
Description: Field Name: VOLUNTARY_AGREEMENT Data Element: HRAU_ATO_PAYEVNTEMPVOLUNTARY_A Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VOLUNTARY_AGREEMENT
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-GROSS_A table field - Business Definition: The total of all gross payments made to
▼
Description: Business Definition: The total of all gross payments made to Field Name: GROSS_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GROSS_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-TAX_WITHHELD_A table field - Business Definition: This is the value, during the relevant
▼
Description: Business Definition: This is the value, during the relevant Field Name: TAX_WITHHELD_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAX_WITHHELD_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-LABOUR_HIRE_ARRANGEMENT_PAYMEN table field -
▼
Description: Field Name: LABOUR_HIRE_ARRANGEMENT_PAYMEN Data Element: HRAU_ATO_PAYEVNTEMPLABOUR_HIRE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LABOUR_HIRE_ARRANGEMENT_PAYMEN
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-GROSS_A table field - Business Definition: The total of all gross payments made to
▼
Description: Business Definition: The total of all gross payments made to Field Name: GROSS_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GROSS_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-TAX_WITHHELD_A table field - Business Definition: This is the value, during the relevant
▼
Description: Business Definition: This is the value, during the relevant Field Name: TAX_WITHHELD_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAX_WITHHELD_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-SPECIFIED_BY_REGULATION_PAYMEN table field -
▼
Description: Field Name: SPECIFIED_BY_REGULATION_PAYMEN Data Element: HRAU_ATO_PAYEVNTEMPSPECIFIED_B Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SPECIFIED_BY_REGULATION_PAYMEN
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-GROSS_A table field - Business Definition: The total of all gross payments made to
▼
Description: Business Definition: The total of all gross payments made to Field Name: GROSS_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GROSS_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-TAX_WITHHELD_A table field - Business Definition: This is the value, during the relevant
▼
Description: Business Definition: This is the value, during the relevant Field Name: TAX_WITHHELD_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAX_WITHHELD_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-JOINT_PETROLEUM_DEVELOPMENT_AR table field -
▼
Description: Field Name: JOINT_PETROLEUM_DEVELOPMENT_AR Data Element: HRAU_ATO_PAYEVNTEMPJOINT_PETRO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field JOINT_PETROLEUM_DEVELOPMENT_AR
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-A table field - Business Definition: The amount received for work or service
▼
Description: Business Definition: The amount received for work or service Field Name: A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-FOREIGN_WITHHOLDING_A table field - Business Definition: The amount of foreign tax withheld duri
▼
Description: Business Definition: The amount of foreign tax withheld duri Field Name: FOREIGN_WITHHOLDING_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FOREIGN_WITHHOLDING_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-TAX_WITHHELD_A table field - Business Definition: This is the value, during the relevant
▼
Description: Business Definition: This is the value, during the relevant Field Name: TAX_WITHHELD_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAX_WITHHELD_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-WORKING_HOLIDAY_MAKER table field -
▼
Description: Field Name: WORKING_HOLIDAY_MAKER Data Element: HRAU_ATO_PAYEVNTEMPWORKING_HOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKING_HOLIDAY_MAKER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-GROSS_A table field - Business Definition: The total of all gross payments made to
▼
Description: Business Definition: The total of all gross payments made to Field Name: GROSS_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GROSS_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-TAX_WITHHELD_A table field - Business Definition: This is the value, during the relevant
▼
Description: Business Definition: This is the value, during the relevant Field Name: TAX_WITHHELD_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAX_WITHHELD_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-PAYMENT_TO_FOREIGN_RESIDENT table field -
▼
Description: Field Name: PAYMENT_TO_FOREIGN_RESIDENT Data Element: HRAU_ATO_PAYEVNTEMPPAYMENT_TO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENT_TO_FOREIGN_RESIDENT
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-GROSS_A table field - Business Definition: The total of all gross payments made to
▼
Description: Business Definition: The total of all gross payments made to Field Name: GROSS_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GROSS_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-FOREIGN_WITHHOLDING_A table field - Business Definition: The amount of foreign tax withheld duri
▼
Description: Business Definition: The amount of foreign tax withheld duri Field Name: FOREIGN_WITHHOLDING_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FOREIGN_WITHHOLDING_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-TAX_WITHHELD_A table field - Business Definition: This is the value, during the relevant
▼
Description: Business Definition: This is the value, during the relevant Field Name: TAX_WITHHELD_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAX_WITHHELD_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-EMPLOYMENT_TERMINATION_PAYMENT table field -
▼
Description: Field Name: EMPLOYMENT_TERMINATION_PAYMENT Data Element: HRAU_ATO_PAYEVNTEMPEMPLOYMENT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EMPLOYMENT_TERMINATION_PAYMENT
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-EMPLOYMENT_TERMINATION_PAYMENT table field -
▼
Description: Field Name: EMPLOYMENT_TERMINATION_PAYMENT Data Element: HRAU_ATO_PAYEVNTEMPEMPLOYM_TAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EMPLOYMENT_TERMINATION_PAYMENT
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-UNUSED_ANNUAL_OR_LONG_SERVICE table field -
▼
Description: Field Name: UNUSED_ANNUAL_OR_LONG_SERVICE Data Element: HRAU_ATO_PAYEVNTEMPUNUSED_ANNU Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field UNUSED_ANNUAL_OR_LONG_SERVICE
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-LUMP_SUM_PAYMENT_A table field -
▼
Description: Field Name: LUMP_SUM_PAYMENT_A Data Element: HRAU_ATO_PAYEVNTEMPLUMP_SUM_PA Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LUMP_SUM_PAYMENT_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-LUMP_SUM_AC table field - Business Guidance: Inform the relevant field with the allowe
▼
Description: Business Guidance: Inform the relevant field with the allowe Field Name: LUMP_SUM_AC Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LUMP_SUM_AC
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-LUMP_SUM_AA table field - Business Definition: The amount paid for unused long service
▼
Description: Business Definition: The amount paid for unused long service Field Name: LUMP_SUM_AA Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LUMP_SUM_AA
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-LUMP_SUM_BA table field - Business Definition: The amount paid for unused long service
▼
Description: Business Definition: The amount paid for unused long service Field Name: LUMP_SUM_BA Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LUMP_SUM_BA
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-LUMP_SUM_DA table field - Business Definition: The amount of genuine redundancy paymen
▼
Description: Business Definition: The amount of genuine redundancy paymen Field Name: LUMP_SUM_DA Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LUMP_SUM_DA
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-LUMP_SUM_EA table field - Business Definition: The amount of back payment received inc
▼
Description: Business Definition: The amount of back payment received inc Field Name: LUMP_SUM_EA Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LUMP_SUM_EA
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-ALLOWANCE_COLLECTION table field -
▼
Description: Field Name: ALLOWANCE_COLLECTION Data Element: HRAU_ATO_PAYEVNTEMPALLOWANCE_C Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ALLOWANCE_COLLECTION
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-ALLOWANCE table field -
▼
Description: Field Name: ALLOWANCE Data Element: HRAU_ATO_PAYEVNTEMPALLOWAN_TAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ALLOWANCE
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-DEDUCTION_COLLECTION table field -
▼
Description: Field Name: DEDUCTION_COLLECTION Data Element: HRAU_ATO_PAYEVNTEMPDEDUCTION_C Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEDUCTION_COLLECTION
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-DEDUCTION table field -
▼
Description: Field Name: DEDUCTION Data Element: HRAU_ATO_PAYEVNTEMPDEDUCTI_TAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEDUCTION
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-SUPERANNUATION_CONTRIBUTION table field -
▼
Description: Field Name: SUPERANNUATION_CONTRIBUTION Data Element: HRAU_ATO_PAYEVNTEMPSUPERANNUAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPERANNUATION_CONTRIBUTION
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-EMPLOYER_CONTRIBUTIONS_SUPERAN table field - Business Definition: Contribution made by an employer for th
▼
Description: Business Definition: Contribution made by an employer for th Field Name: EMPLOYER_CONTRIBUTIONS_SUPERAN Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EMPLOYER_CONTRIBUTIONS_SUPERAN
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-ORDINARY_TIME_EARNINGS_A table field - Business Definition: This is the value, during the relevant
▼
Description: Business Definition: This is the value, during the relevant Field Name: ORDINARY_TIME_EARNINGS_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDINARY_TIME_EARNINGS_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-EMPLOYER_REPORTABLE_A table field - Business Guidance: Contributions made by the employer for an
▼
Description: Business Guidance: Contributions made by the employer for an Field Name: EMPLOYER_REPORTABLE_A Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EMPLOYER_REPORTABLE_A
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-INCOME_FRINGE_BENEFITS_REPORTA table field -
▼
Description: Field Name: INCOME_FRINGE_BENEFITS_REPORTA Data Element: HRAU_ATO_PAYEVNTEMPINCOME_FRIN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INCOME_FRINGE_BENEFITS_REPORTA
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-TAXABLE_INCOME_FRINGE_BENEFITS table field - Business Guidance: Benefits can be provided by employer's as
▼
Description: Business Guidance: Benefits can be provided by employer's as Field Name: TAXABLE_INCOME_FRINGE_BENEFITS Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAXABLE_INCOME_FRINGE_BENEFITS
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-EXEMPT_INCOME_FRINGE_BENEFITS table field - Business Guidance: Benefits can be provided by employer's as
▼
Description: Business Guidance: Benefits can be provided by employer's as Field Name: EXEMPT_INCOME_FRINGE_BENEFITS Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXEMPT_INCOME_FRINGE_BENEFITS
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-ONBOARDING table field -
▼
Description: Field Name: ONBOARDING Data Element: HRAU_ATO_PAYEVNTEMPONBOARDING Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ONBOARDING
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-TFND table field -
▼
Description: Field Name: TFND Data Element: HRAU_ATO_PAYEVNTEMPTFND Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TFND
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-PAYMENT_ARRANGEMENT_TERMINATIO table field - Business Guidance: When a payment arrangement relationship b
▼
Description: Business Guidance: When a payment arrangement relationship b Field Name: PAYMENT_ARRANGEMENT_TERMINATIO Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENT_ARRANGEMENT_TERMINATIO
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-RESIDENCY_TAX_PURPOSES_PERSON table field - Business Guidance: Valid values are:Resident = ResidentNon
▼
Description: Business Guidance: Valid values are:Resident = ResidentNon Field Name: RESIDENCY_TAX_PURPOSES_PERSON Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RESIDENCY_TAX_PURPOSES_PERSON
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-PAYMENT_ARRANGEMENT_PAYMENT_BA table field - Business Guidance: F = Full time payees; P = Part time payee
▼
Description: Business Guidance: F = Full time payees; P = Part time payee Field Name: PAYMENT_ARRANGEMENT_PAYMENT_BA Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENT_ARRANGEMENT_PAYMENT_BA
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-TAX_OFFSET_CLAIM_TAX_FREE_THRE table field - XSD Truth Value: True/False [ext.]
▼
Description: XSD Truth Value: True/False [ext.] Field Name: TAX_OFFSET_CLAIM_TAX_FREE_THRE Data Element: XSDBOOLEAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAX_OFFSET_CLAIM_TAX_FREE_THRE
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-INCOME_TAX_PAY_AS_YOU_GO_WITHH table field - XSD Truth Value: True/False [ext.]
▼
Description: XSD Truth Value: True/False [ext.] Field Name: INCOME_TAX_PAY_AS_YOU_GO_WITHH Data Element: XSDBOOLEAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INCOME_TAX_PAY_AS_YOU_GO_WITHH
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-STUDENT_LOAN_STUDENT_FINANCIAL table field - XSD Truth Value: True/False [ext.]
▼
Description: XSD Truth Value: True/False [ext.] Field Name: STUDENT_LOAN_STUDENT_FINANCIAL Data Element: XSDBOOLEAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STUDENT_LOAN_STUDENT_FINANCIAL
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-DECLARATION table field -
▼
Description: Field Name: DECLARATION Data Element: HRAU_ATO_PAYEVNTEMPDECLARATION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DECLARATION
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-CONTROLLER table field -
▼
Description: Field Name: CONTROLLER Data Element: PRXCTRLTAB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLER
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-STATEMENT_ACCEPTED_I table field - XSD Truth Value: True/False [ext.]
▼
Description: XSD Truth Value: True/False [ext.] Field Name: STATEMENT_ACCEPTED_I Data Element: XSDBOOLEAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STATEMENT_ACCEPTED_I
|
HRAU_ATO_PAYEVNTEMPPAYEVNTEMP-SIGNATURE_D table field - XSD Date: yyyy-mm-dd [ext.]
▼
Description: XSD Date: yyyy-mm-dd [ext.] Field Name: SIGNATURE_D Data Element: XSDDATE_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SIGNATURE_D
|