FMMIMMATTYPVH-MATERIAL table field - Material in Respect of Which Stock is Managed ▼
Description: Material in Respect of Which Stock is Managed Field Name: MATERIAL Data Element: MATBF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit:
FMMIMMATTYPVH-MATERIALTYPE table field - Material Type ▼
Description: Material Type Field Name: MATERIALTYPE Data Element: MTART Data Type: length (Dec): 0(0) Check table: T134 Conversion Routine: Domain Name: MemoryID: MTA AppClass: SHLP: SHLP Field: ConvExit:
FMMIMMATTYPVH-MATERIALTYPENAME table field - Description of Material Type ▼
Description: Description of Material Type Field Name: MATERIALTYPENAME Data Element: MTBEZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: