Details |
FMLVPAYMADV-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
FMLVPAYMADV-PAYMENTADVICE table field - Payment Advice Number
▼
Description: Payment Advice Number Field Name: PAYMENTADVICE Data Element: FARP_PA_AVSID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENTADVICE
|
FMLVPAYMADV-PAYMENTADVICEITEM table field - Payment Advice Item
▼
Description: Payment Advice Item Field Name: PAYMENTADVICEITEM Data Element: AVSPO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENTADVICEITEM
|
FMLVPAYMADV-PAYMENTADVICEACCOUNTTYPE table field - Payment Advice Account Type
▼
Description: Payment Advice Account Type Field Name: PAYMENTADVICEACCOUNTTYPE Data Element: KOART_AV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENTADVICEACCOUNTTYPE
|
FMLVPAYMADV-CREATIONDATE table field - Record Created On
▼
Description: Record Created On Field Name: CREATIONDATE Data Element: ERDAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATE
|
FMLVPAYMADV-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: length (Dec): 0(0) Check table: T001 Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
FMLVPAYMADV-PAYMENTADVICEACCOUNT table field - Account Number
▼
Description: Account Number Field Name: PAYMENTADVICEACCOUNT Data Element: KTONR_AV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENTADVICEACCOUNT
|
FMLVPAYMADV-PAIDAMOUNTINPAYTCURRENCY table field - Payment Amount from the Payment Advice Header
▼
Description: Payment Amount from the Payment Advice Header Field Name: PAIDAMOUNTINPAYTCURRENCY Data Element: RWBTR_AV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAIDAMOUNTINPAYTCURRENCY
|
FMLVPAYMADV-PAYMENTADVICESELECTIONFIELD table field - Name of Selection Field
▼
Description: Name of Selection Field Field Name: PAYMENTADVICESELECTIONFIELD Data Element: SFELD_AV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENTADVICESELECTIONFIELD
|
FMLVPAYMADV-PAYTADVCEXTERNALSELECTIONFIELD table field - Name of External Selection Field Specified
▼
Description: Name of External Selection Field Specified Field Name: PAYTADVCEXTERNALSELECTIONFIELD Data Element: FARP_AFELD_AV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYTADVCEXTERNALSELECTIONFIELD
|
FMLVPAYMADV-ACCOUNTINGDOCUMENT table field - Document Number of an Accounting Document
▼
Description: Document Number of an Accounting Document Field Name: ACCOUNTINGDOCUMENT Data Element: BELNR_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BLN AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTINGDOCUMENT
|
FMLVPAYMADV-DOCUMENTREFERENCEID table field - Reference Document
▼
Description: Reference Document Field Name: DOCUMENTREFERENCEID Data Element: FAR_PA_XBLNR1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTREFERENCEID
|
FMLVPAYMADV-ASSIGNMENTREFERENCE table field - Assignment Number
▼
Description: Assignment Number Field Name: ASSIGNMENTREFERENCE Data Element: FARP_DZUONR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ASSIGNMENTREFERENCE
|
FMLVPAYMADV-INVOICEDATE table field - Document Date
▼
Description: Document Date Field Name: INVOICEDATE Data Element: FARP_PA_REDAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INVOICEDATE
|
FMLVPAYMADV-NETPAYMENTAMOUNTINPAYTCURRENCY table field - Net Payment Amount with +/- Sign
▼
Description: Net Payment Amount with +/- Sign Field Name: NETPAYMENTAMOUNTINPAYTCURRENCY Data Element: NEBTR_AV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NETPAYMENTAMOUNTINPAYTCURRENCY
|
FMLVPAYMADV-CURRENCY table field - Currency Key
▼
Description: Currency Key Field Name: CURRENCY Data Element: WAERS Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: FWS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CURRENCY
|
FMLVPAYMADV-FISCALYEAR table field - Fiscal Year
▼
Description: Fiscal Year Field Name: FISCALYEAR Data Element: GJAHR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: GJR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FISCALYEAR
|
FMLVPAYMADV-PAYMENTDIFFERENCEREASON table field - Reason Code for Payments
▼
Description: Reason Code for Payments Field Name: PAYMENTDIFFERENCEREASON Data Element: RSTGR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENTDIFFERENCEREASON
|
FMLVPAYMADV-DEDUCTIONAMOUNTINPAYTCURRENCY table field - Deduction Amount
▼
Description: Deduction Amount Field Name: DEDUCTIONAMOUNTINPAYTCURRENCY Data Element: FAR_PA_ABBTR_AV Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEDUCTIONAMOUNTINPAYTCURRENCY
|
FMLVPAYMADV-CUSTOMERNAME table field - Name of Customer
▼
Description: Name of Customer Field Name: CUSTOMERNAME Data Element: MD_CUSTOMER_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMERNAME
|
FMLVPAYMADV-CITYNAME table field - City
▼
Description: City Field Name: CITYNAME Data Element: ORT01_GP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CITYNAME
|