Details |
FINCS_LOG_ITEM-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
FINCS_LOG_ITEM-CNSLDTNLOGNUMBER table field - Consolidation Log GUID
▼
Description: Consolidation Log GUID Field Name: CNSLDTNLOGNUMBER Data Element: FINCS_LOGNUMBER Data Type: length (Dec): 0(0) Check table: FINCS_LOG_HEADER Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNLOGNUMBER
|
FINCS_LOG_ITEM-CNSLDTNLOGITEMNUMBER table field - Consolidation Log Item GUID
▼
Description: Consolidation Log Item GUID Field Name: CNSLDTNLOGITEMNUMBER Data Element: FINCS_LOGITEMNUMBER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNLOGITEMNUMBER
|
FINCS_LOG_ITEM-CNSLDTNLINEITEMTYPE table field - Log Line Item Type
▼
Description: Log Line Item Type Field Name: CNSLDTNLINEITEMTYPE Data Element: FINCS_LINEITEMTYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNLINEITEMTYPE
|
FINCS_LOG_ITEM-NODE table field - Node
▼
Description: Node Field Name: NODE Data Element: FINCS_NODE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NODE
|
FINCS_LOG_ITEM-PARENTNODE table field - Node
▼
Description: Node Field Name: PARENTNODE Data Element: FINCS_NODE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARENTNODE
|
FINCS_LOG_ITEM-CNSLDTNGROUP table field - Consolidation Group
▼
Description: Consolidation Group Field Name: CNSLDTNGROUP Data Element: FC_CONGR Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: CGR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNGROUP
|
FINCS_LOG_ITEM-CNSLDTNUNIT table field - Consolidation Unit
▼
Description: Consolidation Unit Field Name: CNSLDTNUNIT Data Element: FC_BUNIT Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: BUN AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNUNIT
|
FINCS_LOG_ITEM-CNSLDTNPARTNERUNIT table field - Partner Unit
▼
Description: Partner Unit Field Name: CNSLDTNPARTNERUNIT Data Element: FC_BUPTR Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNPARTNERUNIT
|
FINCS_LOG_ITEM-CNSLDTNSETIDENTIFICATION table field - Selection
▼
Description: Selection Field Name: CNSLDTNSETIDENTIFICATION Data Element: FINCS_SELID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNSETIDENTIFICATION
|
FINCS_LOG_ITEM-CNSLDTNDOCUMENTNUMBER table field - Document number for the consolidation document
▼
Description: Document number for the consolidation document Field Name: CNSLDTNDOCUMENTNUMBER Data Element: FC_DOCNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: GDN AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNDOCUMENTNUMBER
|
FINCS_LOG_ITEM-CNSLDTNPOSTINGITEM table field - Six-Character General Ledger Line Item
▼
Description: Six-Character General Ledger Line Item Field Name: CNSLDTNPOSTINGITEM Data Element: DOCLN6 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNPOSTINGITEM
|
FINCS_LOG_ITEM-CNSLDTNFINSTMNTITM table field - Financial Statement Item
▼
Description: Financial Statement Item Field Name: CNSLDTNFINSTMNTITM Data Element: FC_ITEM Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: ITM AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNFINSTMNTITM
|
FINCS_LOG_ITEM-CNSLDTNFINSTMNTSUBITMCAT table field - Subitem Category
▼
Description: Subitem Category Field Name: CNSLDTNFINSTMNTSUBITMCAT Data Element: FC_SITYP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: STP AppClass: SHLP: FC_SITYP SHLP Field: SITYP ConvExit: See all SAP tables containing field CNSLDTNFINSTMNTSUBITMCAT
|
FINCS_LOG_ITEM-CNSLDTNFINSTMNTSUBITM table field - Subitem
▼
Description: Subitem Field Name: CNSLDTNFINSTMNTSUBITM Data Element: FC_SITEM Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: STM AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNFINSTMNTSUBITM
|
FINCS_LOG_ITEM-TRANSACTIONCURRENCY table field - Transaction currency
▼
Description: Transaction currency Field Name: TRANSACTIONCURRENCY Data Element: FC_RTCUR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: TCC AppClass: SHLP: FC_WAERS SHLP Field: WAERS ConvExit: See all SAP tables containing field TRANSACTIONCURRENCY
|
FINCS_LOG_ITEM-BASEUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: BASEUNIT Data Element: MEINS Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASEUNIT
|
FINCS_LOG_ITEM-CNSLDTNACQUISITIONYEAR table field - Year of Acquisition
▼
Description: Year of Acquisition Field Name: CNSLDTNACQUISITIONYEAR Data Element: FC_RYACQ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNACQUISITIONYEAR
|
FINCS_LOG_ITEM-CNSLDTNACQUISITIONPERIOD table field - Period of acquisition
▼
Description: Period of acquisition Field Name: CNSLDTNACQUISITIONPERIOD Data Element: FC_RPACQ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNACQUISITIONPERIOD
|
FINCS_LOG_ITEM-CNSLDTNCRCYCNVRSNDIFFTYPE table field - Currency Translation
▼
Description: Currency Translation Field Name: CNSLDTNCRCYCNVRSNDIFFTYPE Data Element: FC_RTFLG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNCRCYCNVRSNDIFFTYPE
|
FINCS_LOG_ITEM-CNSLDTNAPPORTIONMENT table field - Apportionment
▼
Description: Apportionment Field Name: CNSLDTNAPPORTIONMENT Data Element: FC_RPFLG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNAPPORTIONMENT
|
FINCS_LOG_ITEM-CNSLDTNISAUTOPOSTING table field - Automatic line item
▼
Description: Automatic line item Field Name: CNSLDTNISAUTOPOSTING Data Element: FC_AUTOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNISAUTOPOSTING
|
FINCS_LOG_ITEM-PERCENTAGE table field - Tax Rate
▼
Description: Tax Rate Field Name: PERCENTAGE Data Element: FC_TAXRT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERCENTAGE
|
FINCS_LOG_ITEM-AMOUNTINTRANSACTIONCRCY table field - Amount in Balance Transaction Currency
▼
Description: Amount in Balance Transaction Currency Field Name: AMOUNTINTRANSACTIONCRCY Data Element: FINS_VTCUR12 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINTRANSACTIONCRCY
|
FINCS_LOG_ITEM-AMOUNTINLOCALCRCY table field - Amount in Company Code Currency
▼
Description: Amount in Company Code Currency Field Name: AMOUNTINLOCALCRCY Data Element: FINS_VHCUR12 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINLOCALCRCY
|
FINCS_LOG_ITEM-AMOUNTINGROUPCRCY table field - Amount in Global Currency
▼
Description: Amount in Global Currency Field Name: AMOUNTINGROUPCRCY Data Element: FINS_VKCUR12 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AMOUNTINGROUPCRCY
|
FINCS_LOG_ITEM-QUANTITYINBASEUNIT table field - Quantity
▼
Description: Quantity Field Name: QUANTITYINBASEUNIT Data Element: FINCS_QUAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field QUANTITYINBASEUNIT
|
FINCS_LOG_ITEM-CNSLDTNLOCALCURRENCY table field - Local Currency
▼
Description: Local Currency Field Name: CNSLDTNLOCALCURRENCY Data Element: FC_CURR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: FC_WAERS SHLP Field: WAERS ConvExit: See all SAP tables containing field CNSLDTNLOCALCURRENCY
|
FINCS_LOG_ITEM-CNSLDTNGROUPCURRENCY table field - Group Currency
▼
Description: Group Currency Field Name: CNSLDTNGROUPCURRENCY Data Element: FINCS_GROUPCURRENCY Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNGROUPCURRENCY
|
FINCS_LOG_ITEM-SEQNO table field - Sequence number in a method
▼
Description: Sequence number in a method Field Name: SEQNO Data Element: FC_SEQNO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SEQNO
|
FINCS_LOG_ITEM-RECORDINDICATOR table field - Source/Target Indicator
▼
Description: Source/Target Indicator Field Name: RECORDINDICATOR Data Element: FINCS_STINDICATOR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECORDINDICATOR
|
FINCS_LOG_ITEM-CNSLDTNMETHOD table field - Method
▼
Description: Method Field Name: CNSLDTNMETHOD Data Element: FC_CMETH Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNMETHOD
|
FINCS_LOG_ITEM-SORTORDER table field - 4 Byte Signed Integer
▼
Description: 4 Byte Signed Integer Field Name: SORTORDER Data Element: INT4 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SORTORDER
|
FINCS_LOG_ITEM-REEXCHANGERATEINDICATOR table field - Reference exchange rate indicator
▼
Description: Reference exchange rate indicator Field Name: REEXCHANGERATEINDICATOR Data Element: FC_RERIN Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REEXCHANGERATEINDICATOR
|
FINCS_LOG_ITEM-REEXCHAGERATE table field - Reference exchange rate
▼
Description: Reference exchange rate Field Name: REEXCHAGERATE Data Element: FC_RRATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REEXCHAGERATE
|
FINCS_LOG_ITEM-EXCHANGERATEINDICATOR table field - Exchange rate indicator
▼
Description: Exchange rate indicator Field Name: EXCHANGERATEINDICATOR Data Element: FC_EXRIND Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: FC_EXRIND SHLP Field: KURSA ConvExit: See all SAP tables containing field EXCHANGERATEINDICATOR
|
FINCS_LOG_ITEM-EXCHANGERATE table field - Exchange rate
▼
Description: Exchange rate Field Name: EXCHANGERATE Data Element: FC_ERATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXCHANGERATE
|
FINCS_LOG_ITEM-CURRENCYTRANSKEY table field - Currency translation key
▼
Description: Currency translation key Field Name: CURRENCYTRANSKEY Data Element: FC_CTKEY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: FC_CTKEY SHLP Field: VALUE ConvExit: See all SAP tables containing field CURRENCYTRANSKEY
|
FINCS_LOG_ITEM-CNSLDTNFINSTMNTITMR table field - Financial Statement Item
▼
Description: Financial Statement Item Field Name: CNSLDTNFINSTMNTITMR Data Element: FC_ITEM Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: ITM AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNFINSTMNTITMR
|
FINCS_LOG_ITEM-CNSLDTNFINSTMNTSUBITMR table field - Subitem
▼
Description: Subitem Field Name: CNSLDTNFINSTMNTSUBITMR Data Element: FC_SITEM Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: STM AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSLDTNFINSTMNTSUBITMR
|
FINCS_LOG_ITEM-DIFFAMOUNT table field - Translation Difference
▼
Description: Translation Difference Field Name: DIFFAMOUNT Data Element: FINCS_DIFFAMOUNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DIFFAMOUNT
|
FINCS_LOG_ITEM-REFFAMOUNT table field - Reference Amount
▼
Description: Reference Amount Field Name: REFFAMOUNT Data Element: FINCS_REFAMOUNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REFFAMOUNT
|
FINCS_LOG_ITEM-SELECTION_ID table field - Selection ID
▼
Description: Selection ID Field Name: SELECTION_ID Data Element: FINCS_SEL_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SELECTION_ID
|
FINCS_LOG_ITEM-CHARTOFACCOUNTS table field - Chart of Accounts
▼
Description: Chart of Accounts Field Name: CHARTOFACCOUNTS Data Element: KTOPL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: KPL AppClass: SHLP: C_KTOPL SHLP Field: KTOPL ConvExit: See all SAP tables containing field CHARTOFACCOUNTS
|
FINCS_LOG_ITEM-GLACCOUNT table field - Account Number
▼
Description: Account Number Field Name: GLACCOUNT Data Element: RACCT Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: ACC AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GLACCOUNT
|
FINCS_LOG_ITEM-ASSIGNMENTREFERENCE table field - Assignment number
▼
Description: Assignment number Field Name: ASSIGNMENTREFERENCE Data Element: DZUONR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ASSIGNMENTREFERENCE
|
FINCS_LOG_ITEM-COSTCENTER table field - Cost Center
▼
Description: Cost Center Field Name: COSTCENTER Data Element: KOSTL Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: KOS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COSTCENTER
|
FINCS_LOG_ITEM-PROFITCENTER table field - Profit Center
▼
Description: Profit Center Field Name: PROFITCENTER Data Element: PRCTR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PRC AppClass: SHLP: PRCTR_EMPTY SHLP Field: PRCTR ConvExit: See all SAP tables containing field PROFITCENTER
|
FINCS_LOG_ITEM-FUNCTIONALAREA table field - Functional Area
▼
Description: Functional Area Field Name: FUNCTIONALAREA Data Element: FKBER Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: FBE AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FUNCTIONALAREA
|
FINCS_LOG_ITEM-BUSINESSAREA table field - Business Area
▼
Description: Business Area Field Name: BUSINESSAREA Data Element: GSBER Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: GSB AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSAREA
|
FINCS_LOG_ITEM-CONTROLLINGAREA table field - Controlling Area
▼
Description: Controlling Area Field Name: CONTROLLINGAREA Data Element: KOKRS Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: CAC AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLINGAREA
|
FINCS_LOG_ITEM-SEGMENT table field - Segment for Segmental Reporting
▼
Description: Segment for Segmental Reporting Field Name: SEGMENT Data Element: FB_SEGMENT Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SEGMENT
|
FINCS_LOG_ITEM-PARTNERCOSTCENTER table field - Sender cost center
▼
Description: Sender cost center Field Name: PARTNERCOSTCENTER Data Element: SKOST Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: KSK AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARTNERCOSTCENTER
|
FINCS_LOG_ITEM-PARTNERPROFITCENTER table field - Partner Profit Center
▼
Description: Partner Profit Center Field Name: PARTNERPROFITCENTER Data Element: PPRCTR Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: PPC AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARTNERPROFITCENTER
|
FINCS_LOG_ITEM-PARTNERFUNCTIONALAREA table field - Partner Functional Area
▼
Description: Partner Functional Area Field Name: PARTNERFUNCTIONALAREA Data Element: SFKBER Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARTNERFUNCTIONALAREA
|
FINCS_LOG_ITEM-PARTNERBUSINESSAREA table field - Trading partner's business area
▼
Description: Trading partner's business area Field Name: PARTNERBUSINESSAREA Data Element: PARGB Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: GSB AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARTNERBUSINESSAREA
|
FINCS_LOG_ITEM-PARTNERCOMPANY table field - Company ID of Trading Partner
▼
Description: Company ID of Trading Partner Field Name: PARTNERCOMPANY Data Element: RASSC Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: PGS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARTNERCOMPANY
|
FINCS_LOG_ITEM-PARTNERSEGMENT table field - Partner Segment for Segmental Reporting
▼
Description: Partner Segment for Segmental Reporting Field Name: PARTNERSEGMENT Data Element: FB_PSEGMENT Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARTNERSEGMENT
|
FINCS_LOG_ITEM-ORDERID table field - Order Number
▼
Description: Order Number Field Name: ORDERID Data Element: AUFNR Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: ANR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORDERID
|
FINCS_LOG_ITEM-MATERIAL table field - Material Number
▼
Description: Material Number Field Name: MATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field MATERIAL
|
FINCS_LOG_ITEM-MATERIALGROUP table field - Material Group
▼
Description: Material Group Field Name: MATERIALGROUP Data Element: FINS_MATKL_MM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATERIALGROUP
|
FINCS_LOG_ITEM-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
|
FINCS_LOG_ITEM-FINANCIALTRANSACTIONTYPE table field - Transaction type
▼
Description: Transaction type Field Name: FINANCIALTRANSACTIONTYPE Data Element: RMVCT Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINANCIALTRANSACTIONTYPE
|
FINCS_LOG_ITEM-WBSELEMENTINTERNALID table field - Work Breakdown Structure Element (WBS Element)
▼
Description: Work Breakdown Structure Element (WBS Element) Field Name: WBSELEMENTINTERNALID Data Element: PS_PSP_PNR Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WBSELEMENTINTERNALID
|
FINCS_LOG_ITEM-WBSELEMENT table field - Work Breakdown Structure Element (WBS Element)
▼
Description: Work Breakdown Structure Element (WBS Element) Field Name: WBSELEMENT Data Element: PS_POSID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PRO AppClass: SHLP: CC_PRPM SHLP Field: POSID ConvExit: See all SAP tables containing field WBSELEMENT
|
FINCS_LOG_ITEM-PARTNERWBSELEMENT table field - Work Breakdown Structure Element (WBS Element)
▼
Description: Work Breakdown Structure Element (WBS Element) Field Name: PARTNERWBSELEMENT Data Element: PS_POSID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PRO AppClass: SHLP: CC_PRPM SHLP Field: POSID ConvExit: See all SAP tables containing field PARTNERWBSELEMENT
|
FINCS_LOG_ITEM-PROJECT table field - Project definition
▼
Description: Project definition Field Name: PROJECT Data Element: PS_PSPID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PSP AppClass: SHLP: PD_DUMMY SHLP Field: PSPID ConvExit: See all SAP tables containing field PROJECT
|
FINCS_LOG_ITEM-BILLINGDOCUMENTTYPE table field - Billing Type
▼
Description: Billing Type Field Name: BILLINGDOCUMENTTYPE Data Element: FKART Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BILLINGDOCUMENTTYPE
|
FINCS_LOG_ITEM-SALESORGANIZATION table field - Sales Organization
▼
Description: Sales Organization Field Name: SALESORGANIZATION Data Element: VKORG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: VKO AppClass: SHLP: C_VKORG SHLP Field: VKORG ConvExit: See all SAP tables containing field SALESORGANIZATION
|
FINCS_LOG_ITEM-DISTRIBUTIONCHANNEL table field - Distribution Channel
▼
Description: Distribution Channel Field Name: DISTRIBUTIONCHANNEL Data Element: VTWEG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: VTW AppClass: SHLP: C_VTWEG SHLP Field: VTWEG ConvExit: See all SAP tables containing field DISTRIBUTIONCHANNEL
|
FINCS_LOG_ITEM-ORGANIZATIONDIVISION table field - Division
▼
Description: Division Field Name: ORGANIZATIONDIVISION Data Element: SPART Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: SPA AppClass: SHLP: C_SPART SHLP Field: SPART ConvExit: See all SAP tables containing field ORGANIZATIONDIVISION
|
FINCS_LOG_ITEM-SOLDMATERIAL table field - Product Sold
▼
Description: Product Sold Field Name: SOLDMATERIAL Data Element: FINS_MATNR_PA Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOLDMATERIAL
|
FINCS_LOG_ITEM-PRODUCTGROUP table field - Product Sold Group
▼
Description: Product Sold Group Field Name: PRODUCTGROUP Data Element: FINS_MATKL_PA Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: MKL AppClass: SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field PRODUCTGROUP
|
FINCS_LOG_ITEM-CUSTOMERGROUP table field - Customer Group
▼
Description: Customer Group Field Name: CUSTOMERGROUP Data Element: KDGRP Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: VKD AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMERGROUP
|
FINCS_LOG_ITEM-CUSTOMERSUPPLIERCOUNTRY table field - Country/Region Key
▼
Description: Country/Region Key Field Name: CUSTOMERSUPPLIERCOUNTRY Data Element: LAND1 Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: LND AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMERSUPPLIERCOUNTRY
|
FINCS_LOG_ITEM-CUSTOMERSUPPLIERINDUSTRY table field - Industry Key
▼
Description: Industry Key Field Name: CUSTOMERSUPPLIERINDUSTRY Data Element: BRSCH Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMERSUPPLIERINDUSTRY
|
FINCS_LOG_ITEM-SALESDISTRICT table field - Sales District
▼
Description: Sales District Field Name: SALESDISTRICT Data Element: BZIRK Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: BZI AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SALESDISTRICT
|
FINCS_LOG_ITEM-CUSTOMERSUPPLIERCORPORATEGROUP table field - Group key
▼
Description: Group key Field Name: CUSTOMERSUPPLIERCORPORATEGROUP Data Element: KONZS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMERSUPPLIERCORPORATEGROUP
|
FINCS_LOG_ITEM-CUSTOMER table field - Customer Number
▼
Description: Customer Number Field Name: CUSTOMER Data Element: KUNNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: KUN AppClass: SHLP: C_KUNNR SHLP Field: KUNNR ConvExit: See all SAP tables containing field CUSTOMER
|
FINCS_LOG_ITEM-SUPPLIER table field - Account Number of Supplier
▼
Description: Account Number of Supplier Field Name: SUPPLIER Data Element: LIFNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: LIF AppClass: SHLP: KRED_C SHLP Field: LIFNR ConvExit: See all SAP tables containing field SUPPLIER
|
FINCS_LOG_ITEM-SOLDPRODUCT table field - Product Sold
▼
Description: Product Sold Field Name: SOLDPRODUCT Data Element: FINS_MATNR_PA Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SOLDPRODUCT
|
FINCS_LOG_ITEM-SOLDPRODUCTGROUP table field - Product Sold Group
▼
Description: Product Sold Group Field Name: SOLDPRODUCTGROUP Data Element: FINS_MATKL_PA Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: MKL AppClass: SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field SOLDPRODUCTGROUP
|
FINCS_LOG_ITEM-BILLTOPARTY table field - Bill-to Party
▼
Description: Bill-to Party Field Name: BILLTOPARTY Data Element: KUNRE Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: KUN AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BILLTOPARTY
|
FINCS_LOG_ITEM-SHIPTOPARTY table field - Ship-to Party
▼
Description: Ship-to Party Field Name: SHIPTOPARTY Data Element: KUNWE Data Type: length (Dec): 0(0) Check table: * Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SHIPTOPARTY
|
FINCS_LOG_ITEM-DUMMY_CJE_INCL_EEW_PS table field - Custom Fields: Dummy for Use in Extension Includes
▼
Description: Custom Fields: Dummy for Use in Extension Includes Field Name: DUMMY_CJE_INCL_EEW_PS Data Element: CFD_DUMMY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DUMMY_CJE_INCL_EEW_PS
|