Details |
CWVCMPLNCD-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CWVCMPLNCD-CHMLCMPLNCINFOUUID table field - Chemical Compliance Information
▼
Description: Chemical Compliance Information Field Name: CHMLCMPLNCINFOUUID Data Element: EHFND_CCI_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFOUUID
|
CWVCMPLNCD-WORKVIEW table field - Work View ID
▼
Description: Work View ID Field Name: WORKVIEW Data Element: EHFND_WV_ID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKVIEW
|
CWVCMPLNCD-COMPLIANCEDATANAVGNLINKUUID table field - Physical-Chemical Property
▼
Description: Physical-Chemical Property Field Name: COMPLIANCEDATANAVGNLINKUUID Data Element: EHFND_PHYSCHEM_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPLIANCEDATANAVGNLINKUUID
|
CWVCMPLNCD-PCPRPTYROOTTYPE table field - Property Group
▼
Description: Property Group Field Name: PCPRPTYROOTTYPE Data Element: EHFND_PROP_PROPERTY_ROOT Data Type: CHAR length (Dec): 16(0) Check table: Conversion Routine: Domain Name: EHFND_PROP_PROPERTY_ROOT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PCPRPTYROOTTYPE
|
CWVCMPLNCD-CHMLCOMPOSITIONTYPE table field - Legal Area
▼
Description: Legal Area Field Name: CHMLCOMPOSITIONTYPE Data Element: EHFND_CCI_CCMPS_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCOMPOSITIONTYPE
|
CWVCMPLNCD-PRODCMPLNCLEGALAREA table field - Legal Area
▼
Description: Legal Area Field Name: PRODCMPLNCLEGALAREA Data Element: EHFND_LEGAL_AREA Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODCMPLNCLEGALAREA
|
CWVCMPLNCD-CHMLCMPLNCINFOTYPE table field - CCI Type
▼
Description: CCI Type Field Name: CHMLCMPLNCINFOTYPE Data Element: EHFND_CCI_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFOTYPE
|
CWVCMPLNCD-CHMLCMPLNCPRODISRESEARCHED table field - Research and Development Sample
▼
Description: Research and Development Sample Field Name: CHMLCMPLNCPRODISRESEARCHED Data Element: EHFND_CCI_IS_RESEARCHED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCPRODISRESEARCHED
|
CWVCMPLNCD-MATERIALISPRODUCED table field - Product is Produced
▼
Description: Product is Produced Field Name: MATERIALISPRODUCED Data Element: EHFND_CCI_IS_PRODUCED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISPRODUCED
|
CWVCMPLNCD-MATERIALISSOLD table field - Product is Sold
▼
Description: Product is Sold Field Name: MATERIALISSOLD Data Element: EHFND_CCI_IS_SOLD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISSOLD
|
CWVCMPLNCD-MATERIALISSOURCED table field - Product is Sourced
▼
Description: Product is Sourced Field Name: MATERIALISSOURCED Data Element: EHFND_CCI_IS_SOURCED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISSOURCED
|
CWVCMPLNCD-MATERIALISTRANSPORTED table field - Product is Transported
▼
Description: Product is Transported Field Name: MATERIALISTRANSPORTED Data Element: EHFND_CCI_IS_TRANSPORTED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISTRANSPORTED
|
CWVCMPLNCD-CHMLCOMPOSITIONTYPENAME table field - Legal Area Name
▼
Description: Legal Area Name Field Name: CHMLCOMPOSITIONTYPENAME Data Element: EHFND_CCI_CCMPS_TYPE_DSC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCOMPOSITIONTYPENAME
|
CWVCMPLNCD-PCPRPTYROOTTYPENAME table field -
▼
Description: Field Name: PCPRPTYROOTTYPENAME Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PCPRPTYROOTTYPENAME
|
CWVCMPLNCD-COMPLIANCEREQUIREMENT table field - Compliance Requirement
▼
Description: Compliance Requirement Field Name: COMPLIANCEREQUIREMENT Data Element: EHFND_REQ_IDENTIFIER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: EHFND_ELM_REQ_IDENTIFIER SHLP Field: COMPLIANCEREQUIREMENT ConvExit: See all SAP tables containing field COMPLIANCEREQUIREMENT
|
CWVCMPLNCD-CMPLRQVERSUUID table field - Compliance Requirement UUID
▼
Description: Compliance Requirement UUID Field Name: CMPLRQVERSUUID Data Element: EHFND_CRV_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQVERSUUID
|
CWVCMPLNCD-CMPLRQVERSNAME table field - Compliance Requirement Name
▼
Description: Compliance Requirement Name Field Name: CMPLRQVERSNAME Data Element: EHFND_CRR_CRV_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQVERSNAME
|
CWVCMPLNCD-COMPLIANCEDATANAME table field - Compliance Requirement Name
▼
Description: Compliance Requirement Name Field Name: COMPLIANCEDATANAME Data Element: EHFND_CRR_CRV_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPLIANCEDATANAME
|
CWVCMPLNCD-PCPRPTYINPROCPROCGSTS table field - Processing Status for a Property
▼
Description: Processing Status for a Property Field Name: PCPRPTYINPROCPROCGSTS Data Element: EHFND_PROPERTY_STATUS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PCPRPTYINPROCPROCGSTS
|
CWVCMPLNCD-PCPRPTYRELDPROCGSTS table field - Processing Status for a Property
▼
Description: Processing Status for a Property Field Name: PCPRPTYRELDPROCGSTS Data Element: EHFND_PROPERTY_STATUS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PCPRPTYRELDPROCGSTS
|
CWVCMPLNCD-PCPRPTYPROCGSTS table field - Processing Status for a Property
▼
Description: Processing Status for a Property Field Name: PCPRPTYPROCGSTS Data Element: EHFND_PROPERTY_STATUS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PCPRPTYPROCGSTS
|
CWVCMPLNCD-PCPRPTYPROCGSTSTEXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: PCPRPTYPROCGSTSTEXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PCPRPTYPROCGSTSTEXT
|
CWVCMPLNCD-PROCESSINGSTATUS table field - Processing Status of a Compliance Requirement
▼
Description: Processing Status of a Compliance Requirement Field Name: PROCESSINGSTATUS Data Element: EHFND_CRR_PROC_STATUS Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: EHFND_CRR_PROCSTAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROCESSINGSTATUS
|
CWVCMPLNCD-PCPRPTYPROCGSTSCRITLTY table field -
▼
Description: Field Name: PCPRPTYPROCGSTSCRITLTY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PCPRPTYPROCGSTSCRITLTY
|
CWVCMPLNCD-PROCESSORUSERNAME table field - Processor/Released By
▼
Description: Processor/Released By Field Name: PROCESSORUSERNAME Data Element: EHPMA_PROCESSOR_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROCESSORUSERNAME
|
CWVCMPLNCD-RELEASEDBYUSERNAME table field - Description of the Technical User Account
▼
Description: Description of the Technical User Account Field Name: RELEASEDBYUSERNAME Data Element: SUIDTECHDESC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RELEASEDBYUSERNAME
|
CWVCMPLNCD-COMPLIANCEDATAUSERNAME table field - Processor/Released By
▼
Description: Processor/Released By Field Name: COMPLIANCEDATAUSERNAME Data Element: EHPMA_PROCESSOR_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPLIANCEDATAUSERNAME
|
CWVCMPLNCD-WORKVIEWGROUPNAME table field - Work View Group Name
▼
Description: Work View Group Name Field Name: WORKVIEWGROUPNAME Data Element: EHFND_WV_GROUP_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKVIEWGROUPNAME
|
CWVCMPLNCD-SEMANTICOBJECT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: SEMANTICOBJECT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SEMANTICOBJECT
|
CWVCMPLNCD-SEMANTICOBJECTACTION table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: SEMANTICOBJECTACTION Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SEMANTICOBJECTACTION
|
CWVCMPLNCD-PCPRPTYNAVGNLINKPARAMNAME table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: PCPRPTYNAVGNLINKPARAMNAME Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PCPRPTYNAVGNLINKPARAMNAME
|
CWVCMPLNCD-PCPRPTYACTIVEINDPARAMNAME table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: PCPRPTYACTIVEINDPARAMNAME Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PCPRPTYACTIVEINDPARAMNAME
|
CWVCMPLNCD-PRODSTEWARDSHIPRESPUNIT table field - Responsible Unit
▼
Description: Responsible Unit Field Name: PRODSTEWARDSHIPRESPUNIT Data Element: EHFND_CCI_RESPONSIBLE_UNIT_PSS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODSTEWARDSHIPRESPUNIT
|
CWVCMPLNCD-DNGRSGDSRESPUNIT table field - Responsible Unit for Dangerous Goods
▼
Description: Responsible Unit for Dangerous Goods Field Name: DNGRSGDSRESPUNIT Data Element: EHFND_CCI_RESPONSIBLE_UNIT_DG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DNGRSGDSRESPUNIT
|
CWVCMPLNCD-CHMLCMPLNCINTERNALNAME table field - Internal Name
▼
Description: Internal Name Field Name: CHMLCMPLNCINTERNALNAME Data Element: EHFND_CCI_INTERNAL_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINTERNALNAME
|
CWVCMPLNCD-CMPLRQPATTERN table field -
▼
Description: Field Name: CMPLRQPATTERN Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQPATTERN
|
CWVCMPLNCD-PCPRPTYSEQUENCE table field - Sequence of Property
▼
Description: Sequence of Property Field Name: PCPRPTYSEQUENCE Data Element: EHFND_PROPERTY_SEQUENCE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PCPRPTYSEQUENCE
|