Details |
CPVWCDVLQ-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CPVWCDVLQ-WELLCOMPLTNVOLDOCYR table field - WC Volumes Document Year
▼
Description: WC Volumes Document Year Field Name: WELLCOMPLTNVOLDOCYR Data Element: OIU_VDM_WC_VOL_DOC_YEAR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WELLCOMPLTNVOLDOCYR
|
CPVWCDVLQ-WELLCOMPLTNVOLDOC table field - Well Completion Delivery Volume Header Number
▼
Description: Well Completion Delivery Volume Header Number Field Name: WELLCOMPLTNVOLDOC Data Element: OIU_WCDVLH_NO Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: OIU_DOCNR MemoryID: OIU_DOCNR AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field WELLCOMPLTNVOLDOC
|
CPVWCDVLQ-WELL table field - Well ID number
▼
Description: Well ID number Field Name: WELL Data Element: OIU_WL_NO Data Type: length (Dec): 0(0) Check table: OIU_PR_WELL Conversion Routine: Domain Name: MemoryID: OIU_WELL AppClass: SHLP: H_OIU_PR_WELL SHLP Field: WL_NO ConvExit: See all SAP tables containing field WELL
|
CPVWCDVLQ-WELLCOMPLETION table field - Well Completion Number
▼
Description: Well Completion Number Field Name: WELLCOMPLETION Data Element: OIU_WC_NO Data Type: length (Dec): 0(0) Check table: OIU_PR_WC Conversion Routine: Domain Name: MemoryID: OIU_WC AppClass: SHLP: H_OIU_PR_WC SHLP Field: WC_NO ConvExit: See all SAP tables containing field WELLCOMPLETION
|
CPVWCDVLQ-DELIVERYNETWORK table field - Delivery network number
▼
Description: Delivery network number Field Name: DELIVERYNETWORK Data Element: OIU_DN_NO Data Type: CHAR length (Dec): 20(0) Check table: OIU_PR_DN Conversion Routine: ALPHA Domain Name: OIU_DN_NO MemoryID: OIU_DN AppClass: SHLP: H_OIU_PR_DN SHLP Field: DN_NO ConvExit: ALPHA See all SAP tables containing field DELIVERYNETWORK
|
CPVWCDVLQ-EFFECTIVEVALIDITYSTARTDATE table field - Effective from date
▼
Description: Effective from date Field Name: EFFECTIVEVALIDITYSTARTDATE Data Element: OIU_EFF_FROM_DT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_EFD AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EFFECTIVEVALIDITYSTARTDATE
|
CPVWCDVLQ-EFFECTIVEVALIDITYENDDATE table field - Effective To Date
▼
Description: Effective To Date Field Name: EFFECTIVEVALIDITYENDDATE Data Element: OIU_EFF_TO_DT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_ETD AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EFFECTIVEVALIDITYENDDATE
|
CPVWCDVLQ-PRODUCTIONDATE table field - Production date
▼
Description: Production date Field Name: PRODUCTIONDATE Data Element: OIU_PRD_DT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_PRD_DATE AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTIONDATE
|
CPVWCDVLQ-RECLASSIFIEDMATERIAL table field - Production Material
▼
Description: Production Material Field Name: RECLASSIFIEDMATERIAL Data Element: OIU_PRD_MATNR Data Type: length (Dec): 0(0) Check table: OIU_CM_MAT_PRCD Conversion Routine: Domain Name: MemoryID: OIU_PRD_MATNR AppClass: SHLP: H_OIU_CM_MAT SHLP Field: MATNR ConvExit: See all SAP tables containing field RECLASSIFIEDMATERIAL
|
CPVWCDVLQ-MATERIAL table field - Material Number
▼
Description: Material Number Field Name: MATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: OIU_CM_MAT_PRCD Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field MATERIAL
|
CPVWCDVLQ-ALLOCATIONFREQUENCY table field - Frequency
▼
Description: Frequency Field Name: ALLOCATIONFREQUENCY Data Element: OIU_FREQ_CD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_FRQ AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ALLOCATIONFREQUENCY
|
CPVWCDVLQ-TANKBATTERYMEASUREMENTPT table field - Tank battery measurement point number
▼
Description: Tank battery measurement point number Field Name: TANKBATTERYMEASUREMENTPT Data Element: OIU_TKBTRY_MP_NO Data Type: length (Dec): 0(0) Check table: OIU_PR_MP Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TANKBATTERYMEASUREMENTPT
|
CPVWCDVLQ-VOLUMETYPE table field - Volume type code
▼
Description: Volume type code Field Name: VOLUMETYPE Data Element: OIU_VT_CD Data Type: length (Dec): 0(0) Check table: OIU_PR_VLTYP Conversion Routine: Domain Name: MemoryID: OIU_VTCD AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VOLUMETYPE
|
CPVWCDVLQ-VOLUMECLASS table field - Volume class code
▼
Description: Volume class code Field Name: VOLUMECLASS Data Element: OIU_VC_CD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_VCCD AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VOLUMECLASS
|
CPVWCDVLQ-VOLUMESOURCE table field - Volume Source Code
▼
Description: Volume Source Code Field Name: VOLUMESOURCE Data Element: OIU_VS_CD Data Type: length (Dec): 0(0) Check table: OIU_PR_VLSRC Conversion Routine: Domain Name: MemoryID: OIU_VS_CD AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VOLUMESOURCE
|
CPVWCDVLQ-TRANSPORTER table field - Transporter number
▼
Description: Transporter number Field Name: TRANSPORTER Data Element: OIU_TRNSP_NO Data Type: length (Dec): 0(0) Check table: KNA1 Conversion Routine: Domain Name: MemoryID: OIU_TRNSP_NO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSPORTER
|
CPVWCDVLQ-TRANSPORTERREFERENCE table field - Transporter Reference Number
▼
Description: Transporter Reference Number Field Name: TRANSPORTERREFERENCE Data Element: OIU_TRNSP_REF_NO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_TRNSP_R AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSPORTERREFERENCE
|
CPVWCDVLQ-TICKETNUMBER table field - Ticket number
▼
Description: Ticket number Field Name: TICKETNUMBER Data Element: OIU_TKT_NO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: OIU_TKT_NO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TICKETNUMBER
|
CPVWCDVLQ-TICKETDATETIME table field - Ticket Timestamp (Date)
▼
Description: Ticket Timestamp (Date) Field Name: TICKETDATETIME Data Element: OIU_TKT_TIMESTP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TICKETDATETIME
|
CPVWCDVLQ-ORIGINATINGMEASUREMENTPT table field - Original measurement point number
▼
Description: Original measurement point number Field Name: ORIGINATINGMEASUREMENTPT Data Element: OIU_ORIG_MP_NO Data Type: length (Dec): 0(0) Check table: OIU_PR_MP Conversion Routine: Domain Name: MemoryID: OIU_ORIG_MP_NO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ORIGINATINGMEASUREMENTPT
|
CPVWCDVLQ-CONVERSIONGROUP table field - Conversion Group (Oil, Natural Gas,..)
▼
Description: Conversion Group (Oil, Natural Gas,..) Field Name: CONVERSIONGROUP Data Element: OIB_UMRSL Data Type: length (Dec): 0(0) Check table: OIB01 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONVERSIONGROUP
|
CPVWCDVLQ-DENSITYTYPE table field - Density Type
▼
Description: Density Type Field Name: DENSITYTYPE Data Element: OIU_DNTYP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DENSITYTYPE
|
CPVWCDVLQ-INVENTORYDATE table field - Inventory date
▼
Description: Inventory date Field Name: INVENTORYDATE Data Element: OIU_INV_DT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INVENTORYDATE
|
CPVWCDVLQ-CROSSREFWELL table field - Cross-Reference Well Number
▼
Description: Cross-Reference Well Number Field Name: CROSSREFWELL Data Element: OIU_XREF_WL_NO Data Type: length (Dec): 0(0) Check table: OIU_PR_WELL Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CROSSREFWELL
|
CPVWCDVLQ-CROSSREFWELLCOMPLETION table field - Cross-Reference Wellcompletion Number
▼
Description: Cross-Reference Wellcompletion Number Field Name: CROSSREFWELLCOMPLETION Data Element: OIU_XREF_WC_NO Data Type: length (Dec): 0(0) Check table: OIU_PR_WC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CROSSREFWELLCOMPLETION
|
CPVWCDVLQ-CREATEDBYUSER table field - Created By
▼
Description: Created By Field Name: CREATEDBYUSER Data Element: FCLM_BAM_CREATED_BY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
CPVWCDVLQ-CREATIONDATETIME table field - Created On Timestamp
▼
Description: Created On Timestamp Field Name: CREATIONDATETIME Data Element: OIU_VDM_CREATED_ON_TS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATETIME
|
CPVWCDVLQ-STANDARDVOLUNIT table field - Standard volume unit
▼
Description: Standard volume unit Field Name: STANDARDVOLUNIT Data Element: OIU_STD_VOL_U Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STANDARDVOLUNIT
|
CPVWCDVLQ-ENERGYUNIT table field - Energy quantity unit
▼
Description: Energy quantity unit Field Name: ENERGYUNIT Data Element: OIU_ENERGY_U Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENERGYUNIT
|
CPVWCDVLQ-THRTCLVOLUNIT table field - Theoretical Unit
▼
Description: Theoretical Unit Field Name: THRTCLVOLUNIT Data Element: OIU_THEO_U Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field THRTCLVOLUNIT
|
CPVWCDVLQ-HEATINGVALUNIT table field - Heating Value Unit
▼
Description: Heating Value Unit Field Name: HEATINGVALUNIT Data Element: OIU_HEAT_VAL_U Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: OUMH SHLP Field: MSEHI ConvExit: See all SAP tables containing field HEATINGVALUNIT
|
CPVWCDVLQ-STANDARDDENSITYUNIT table field - Unit for densities at standard/base conditions
▼
Description: Unit for densities at standard/base conditions Field Name: STANDARDDENSITYUNIT Data Element: OIU_BDNEH Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STANDARDDENSITYUNIT
|
CPVWCDVLQ-HEATINGVALUE table field - Heating value
▼
Description: Heating value Field Name: HEATINGVALUE Data Element: OIU_HEAT_VAL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HEATINGVALUE
|
CPVWCDVLQ-STANDARDDENSITY table field - Oil/gas density at standard/base conditions
▼
Description: Oil/gas density at standard/base conditions Field Name: STANDARDDENSITY Data Element: OIU_BDICH Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STANDARDDENSITY
|
CPVWCDVLQ-NMBROFDAYSPRODUCED table field - Days of Production
▼
Description: Days of Production Field Name: NMBROFDAYSPRODUCED Data Element: OIU_VDM_INT_DAYS_OF_PROD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFDAYSPRODUCED
|
CPVWCDVLQ-NMBROFHOURSPRODUCED table field - Days of Production
▼
Description: Days of Production Field Name: NMBROFHOURSPRODUCED Data Element: OIU_VDM_INT_HRS_OF_PROD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFHOURSPRODUCED
|
CPVWCDVLQ-NUMBEROFITEMS table field - Number of Items
▼
Description: Number of Items Field Name: NUMBEROFITEMS Data Element: OIU_VDM_NO_OF_ITEMS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFITEMS
|
CPVWCDVLQ-THEORETICALVOLUME table field - Theoretical Volume
▼
Description: Theoretical Volume Field Name: THEORETICALVOLUME Data Element: OIU_THEO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field THEORETICALVOLUME
|
CPVWCDVLQ-STANDARDVOLUME table field - Standard volume
▼
Description: Standard volume Field Name: STANDARDVOLUME Data Element: OIU_STD_VOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STANDARDVOLUME
|
CPVWCDVLQ-ENERGY table field - Energy quantity
▼
Description: Energy quantity Field Name: ENERGY Data Element: OIU_ENERGY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ENERGY
|
CPVWCDVLQ-GASMOLARVOLUME table field - Gas mol volume
▼
Description: Gas mol volume Field Name: GASMOLARVOLUME Data Element: OIU_MOL_VOLUME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GASMOLARVOLUME
|