Details |
CPURREQITEMFS-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CPURREQITEMFS-PURCHASEREQUISITION table field - Purchase Requisition Number
▼
Description: Purchase Requisition Number Field Name: PURCHASEREQUISITION Data Element: VDM_PURCHASEREQUISITION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BAN AppClass: SHLP: MBAN_C SHLP Field: BANFN ConvExit: See all SAP tables containing field PURCHASEREQUISITION
|
CPURREQITEMFS-PURCHASEREQUISITIONITEM table field - Item number of purchase requisition
▼
Description: Item number of purchase requisition Field Name: PURCHASEREQUISITIONITEM Data Element: VDM_PURCHASEREQUISITIONITEM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BAP AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQUISITIONITEM
|
CPURREQITEMFS-PROCMTHUBPURREQNITMISCHANGED table field - Change Indicator for PR in Central Procurement
▼
Description: Change Indicator for PR in Central Procurement Field Name: PROCMTHUBPURREQNITMISCHANGED Data Element: MM_PUR_HUB_CHGIND Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROCMTHUBPURREQNITMISCHANGED
|
CPURREQITEMFS-PURCHASEREQUISITIONITEMTEXT table field - Short Text
▼
Description: Short Text Field Name: PURCHASEREQUISITIONITEMTEXT Data Element: TXZ01 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQUISITIONITEMTEXT
|
CPURREQITEMFS-MATERIAL table field - Material Number
▼
Description: Material Number Field Name: MATERIAL Data Element: MATNR Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field MATERIAL
|
CPURREQITEMFS-EXTMATERIALFORPURG table field - Material of External System
▼
Description: Material of External System Field Name: EXTMATERIALFORPURG Data Element: MM_PUR_HUB_MATNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXTMATERIALFORPURG
|
CPURREQITEMFS-MATERIALGROUP table field - Material Group
▼
Description: Material Group Field Name: MATERIALGROUP Data Element: MATKL Data Type: length (Dec): 0(0) Check table: T023 Conversion Routine: Domain Name: MemoryID: MKL AppClass: SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATERIALGROUP
|
CPURREQITEMFS-PURCHASEREQUISITIONTYPE table field - Purchase Requisition Document Type
▼
Description: Purchase Requisition Document Type Field Name: PURCHASEREQUISITIONTYPE Data Element: BBSRT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BBA AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQUISITIONTYPE
|
CPURREQITEMFS-PURCHASINGDOCUMENTITEMCATEGORY table field - Item category in purchasing document
▼
Description: Item category in purchasing document Field Name: PURCHASINGDOCUMENTITEMCATEGORY Data Element: PSTYP Data Type: length (Dec): 0(0) Check table: T163 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGDOCUMENTITEMCATEGORY
|
CPURREQITEMFS-PURGDOCITEMCATEGORYNAME table field - Text for Item Category
▼
Description: Text for Item Category Field Name: PURGDOCITEMCATEGORYNAME Data Element: PTEXT_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURGDOCITEMCATEGORYNAME
|
CPURREQITEMFS-PURCHASEREQUISITIONPRICE table field - Price in Purchase Requisition
▼
Description: Price in Purchase Requisition Field Name: PURCHASEREQUISITIONPRICE Data Element: BAPRE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQUISITIONPRICE
|
CPURREQITEMFS-PURREQNITEMTOTALAMOUNT table field - Purchase Requisition Item Total Amount
▼
Description: Purchase Requisition Item Total Amount Field Name: PURREQNITEMTOTALAMOUNT Data Element: MM_PUR_REQUISITION_ITEM_AMOUNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNITEMTOTALAMOUNT
|
CPURREQITEMFS-PURREQNPRICEQUANTITY table field - Price unit
▼
Description: Price unit Field Name: PURREQNPRICEQUANTITY Data Element: EPEIN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNPRICEQUANTITY
|
CPURREQITEMFS-PURREQNITEMCURRENCY table field - Currency Key
▼
Description: Currency Key Field Name: PURREQNITEMCURRENCY Data Element: WAERS Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: FWS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNITEMCURRENCY
|
CPURREQITEMFS-PURREQNRELEASESTATUS table field - Requisition Processing State
▼
Description: Requisition Processing State Field Name: PURREQNRELEASESTATUS Data Element: BANPR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNRELEASESTATUS
|
CPURREQITEMFS-EXTERNALAPPROVALSTATUS table field - External Processing Status
▼
Description: External Processing Status Field Name: EXTERNALAPPROVALSTATUS Data Element: MMPUR_REQ_EXTAPPRVLSTS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXTERNALAPPROVALSTATUS
|
CPURREQITEMFS-PURCHASEREQNITEMUNIQUEID table field - Key to identify purchase requisition item
▼
Description: Key to identify purchase requisition item Field Name: PURCHASEREQNITEMUNIQUEID Data Element: MM_PUR_PR_ITEM_KEY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQNITEMUNIQUEID
|
CPURREQITEMFS-PROCESSINGSTATUS table field - Processing status of purchase requisition
▼
Description: Processing status of purchase requisition Field Name: PROCESSINGSTATUS Data Element: BANST Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROCESSINGSTATUS
|
CPURREQITEMFS-PROCESSINGSTATUSNAME table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: PROCESSINGSTATUSNAME Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROCESSINGSTATUSNAME
|
CPURREQITEMFS-PFMTRANSDATAFOOTPRINTUUID table field - Transaction Data Footprint
▼
Description: Transaction Data Footprint Field Name: PFMTRANSDATAFOOTPRINTUUID Data Element: PFMTRANSDATAFOOTPRINTUUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PFMTRANSDATAFOOTPRINTUUID
|
CPURREQITEMFS-PFMFOOTPRINTQUANTITY table field - Footprint Quantity
▼
Description: Footprint Quantity Field Name: PFMFOOTPRINTQUANTITY Data Element: PFMFOOTPRINTQUANTITY_QUAN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PFMFOOTPRINTQUANTITY
|
CPURREQITEMFS-PFMFOOTPRINTUNIT table field - Footprint Unit
▼
Description: Footprint Unit Field Name: PFMFOOTPRINTUNIT Data Element: PFMFOOTPRINTUNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PFMFOOTPRINTUNIT
|
CPURREQITEMFS-REQUESTEDQUANTITY table field - Purchase requisition quantity
▼
Description: Purchase requisition quantity Field Name: REQUESTEDQUANTITY Data Element: BAMNG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQUESTEDQUANTITY
|
CPURREQITEMFS-BASEUNIT table field - Purchase requisition unit of measure
▼
Description: Purchase requisition unit of measure Field Name: BASEUNIT Data Element: BAMEI Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASEUNIT
|
CPURREQITEMFS-FORMATTEDPURREQUISITIONITEM table field - Formatted Purchase Requisition Item
▼
Description: Formatted Purchase Requisition Item Field Name: FORMATTEDPURREQUISITIONITEM Data Element: MM_PUR_REQUISITION_FRMTDPRITEM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FORMATTEDPURREQUISITIONITEM
|
CPURREQITEMFS-PURCHASINGGROUP table field - Purchasing Group
▼
Description: Purchasing Group Field Name: PURCHASINGGROUP Data Element: EKGRP Data Type: length (Dec): 0(0) Check table: T024 Conversion Routine: Domain Name: MemoryID: EKG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGGROUP
|
CPURREQITEMFS-PURCHASINGORGANIZATION table field - Purchasing Organization
▼
Description: Purchasing Organization Field Name: PURCHASINGORGANIZATION Data Element: EKORG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: EKO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGORGANIZATION
|
CPURREQITEMFS-PLAINLONGTEXT table field -
▼
Description: Field Name: PLAINLONGTEXT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLAINLONGTEXT
|
CPURREQITEMFS-ADDRESSID table field - Number of delivery address
▼
Description: Number of delivery address Field Name: ADDRESSID Data Element: ADRN2 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ADDRESSID
|
CPURREQITEMFS-FIXEDSUPPLIER table field - Fixed Vendor
▼
Description: Fixed Vendor Field Name: FIXEDSUPPLIER Data Element: FLIEF Data Type: length (Dec): 0(0) Check table: LFA1 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FIXEDSUPPLIER
|
CPURREQITEMFS-EXTFIXEDSUPPLIERFORPURG table field - Fixed Supplier of External System
▼
Description: Fixed Supplier of External System Field Name: EXTFIXEDSUPPLIERFORPURG Data Element: MM_PUR_HUB_FLIEF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXTFIXEDSUPPLIERFORPURG
|
CPURREQITEMFS-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
|
CPURREQITEMFS-STORAGELOCATION table field - Storage Location
▼
Description: Storage Location Field Name: STORAGELOCATION Data Element: LGORT_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: LAG AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STORAGELOCATION
|
CPURREQITEMFS-PURCHASINGDOCUMENT table field - Purchase order number
▼
Description: Purchase order number Field Name: PURCHASINGDOCUMENT Data Element: BSTNR Data Type: length (Dec): 0(0) Check table: EKKO Conversion Routine: Domain Name: MemoryID: BES AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASINGDOCUMENT
|
CPURREQITEMFS-SUPPLIER table field - Desired Vendor
▼
Description: Desired Vendor Field Name: SUPPLIER Data Element: WLIEF Data Type: length (Dec): 0(0) Check table: LFA1 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLIER
|
CPURREQITEMFS-EXTDESIREDSUPPLIERFORPURG table field - Desired Supplier of External System
▼
Description: Desired Supplier of External System Field Name: EXTDESIREDSUPPLIERFORPURG Data Element: MM_PUR_HUB_WLIEF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXTDESIREDSUPPLIERFORPURG
|
CPURREQITEMFS-ISDELETED table field - Deletion Indicator in Purchasing Document
▼
Description: Deletion Indicator in Purchasing Document Field Name: ISDELETED Data Element: ELOEK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISDELETED
|
CPURREQITEMFS-CREATEDBYUSER table field - Name of Person Responsible for Creating the Object
▼
Description: Name of Person Responsible for Creating the Object Field Name: CREATEDBYUSER Data Element: ERNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
CPURREQITEMFS-PURREQNSSPREQUESTOR table field - Full Name of Person
▼
Description: Full Name of Person Field Name: PURREQNSSPREQUESTOR Data Element: AD_NAMTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNSSPREQUESTOR
|
CPURREQITEMFS-PURREQNREQUESTORFULLNAME table field - Full Name of Person
▼
Description: Full Name of Person Field Name: PURREQNREQUESTORFULLNAME Data Element: AD_NAMTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNREQUESTORFULLNAME
|
CPURREQITEMFS-PURREQNREQUESTOR table field - Requestor
▼
Description: Requestor Field Name: PURREQNREQUESTOR Data Element: MMPUR_REQ_D_REQUESTOR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNREQUESTOR
|
CPURREQITEMFS-REQUISITIONERNAME table field - Name of requisitioner/requester
▼
Description: Name of requisitioner/requester Field Name: REQUISITIONERNAME Data Element: AFNAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REQUISITIONERNAME
|
CPURREQITEMFS-USERFULLNAME table field - Full Name of Person
▼
Description: Full Name of Person Field Name: USERFULLNAME Data Element: AD_NAMTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field USERFULLNAME
|
CPURREQITEMFS-DELIVERYDATE table field - Item Delivery Date
▼
Description: Item Delivery Date Field Name: DELIVERYDATE Data Element: EINDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DELIVERYDATE
|
CPURREQITEMFS-PURREQNITMCONFIDENCELEVELDESC table field -
▼
Description: Field Name: PURREQNITMCONFIDENCELEVELDESC Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNITMCONFIDENCELEVELDESC
|
CPURREQITEMFS-UTILSMCHNLRNGRELCONFIDENCEVAL table field - Data Element Length 11
▼
Description: Data Element Length 11 Field Name: UTILSMCHNLRNGRELCONFIDENCEVAL Data Element: CHAR11 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field UTILSMCHNLRNGRELCONFIDENCEVAL
|
CPURREQITEMFS-PURREQNAPPRVLRANK1FEATUREDESC table field -
▼
Description: Field Name: PURREQNAPPRVLRANK1FEATUREDESC Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK1FEATUREDESC
|
CPURREQITEMFS-PURREQNAPPRVLRANK1FEATURE table field - Intelligent Approval Attribute 1
▼
Description: Intelligent Approval Attribute 1 Field Name: PURREQNAPPRVLRANK1FEATURE Data Element: MMPUR_ML_FEATURE_NAME1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK1FEATURE
|
CPURREQITEMFS-PURREQNAPPRVLRANK1FEATUREVALUE table field - Value for Intelligent Approval Attribute 1
▼
Description: Value for Intelligent Approval Attribute 1 Field Name: PURREQNAPPRVLRANK1FEATUREVALUE Data Element: MMPUR_ML_FEATURE_VALUE1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK1FEATUREVALUE
|
CPURREQITEMFS-PURREQNAPPRVLRANK2FEATUREDESC table field -
▼
Description: Field Name: PURREQNAPPRVLRANK2FEATUREDESC Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK2FEATUREDESC
|
CPURREQITEMFS-PURREQNAPPRVLRANK2FEATURE table field - Intelligent Approval Attribute 2
▼
Description: Intelligent Approval Attribute 2 Field Name: PURREQNAPPRVLRANK2FEATURE Data Element: MMPUR_ML_FEATURE_NAME2 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK2FEATURE
|
CPURREQITEMFS-PURREQNAPPRVLRANK2FEATUREVALUE table field - Value for Intelligent Approval Attribute 2
▼
Description: Value for Intelligent Approval Attribute 2 Field Name: PURREQNAPPRVLRANK2FEATUREVALUE Data Element: MMPUR_ML_FEATURE_VALUE2 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK2FEATUREVALUE
|
CPURREQITEMFS-PURREQNAPPRVLRANK3FEATUREDESC table field -
▼
Description: Field Name: PURREQNAPPRVLRANK3FEATUREDESC Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK3FEATUREDESC
|
CPURREQITEMFS-PURREQNAPPRVLRANK3FEATURE table field - Intelligent Approval Attribute 3
▼
Description: Intelligent Approval Attribute 3 Field Name: PURREQNAPPRVLRANK3FEATURE Data Element: MMPUR_ML_FEATURE_NAME3 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK3FEATURE
|
CPURREQITEMFS-PURREQNAPPRVLRANK3FEATUREVALUE table field - Value for Intelligent Approval Attribute 3
▼
Description: Value for Intelligent Approval Attribute 3 Field Name: PURREQNAPPRVLRANK3FEATUREVALUE Data Element: MMPUR_ML_FEATURE_VALUE3 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK3FEATUREVALUE
|
CPURREQITEMFS-PURREQNAPPRVLRANK4FEATUREDESC table field -
▼
Description: Field Name: PURREQNAPPRVLRANK4FEATUREDESC Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK4FEATUREDESC
|
CPURREQITEMFS-PURREQNAPPRVLRANK4FEATURE table field - Intelligent Approval Attribute 4
▼
Description: Intelligent Approval Attribute 4 Field Name: PURREQNAPPRVLRANK4FEATURE Data Element: MMPUR_ML_FEATURE_NAME4 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK4FEATURE
|
CPURREQITEMFS-PURREQNAPPRVLRANK4FEATUREVALUE table field - Value for Intelligent Approval Attribute 4
▼
Description: Value for Intelligent Approval Attribute 4 Field Name: PURREQNAPPRVLRANK4FEATUREVALUE Data Element: MMPUR_ML_FEATURE_VALUE4 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK4FEATUREVALUE
|
CPURREQITEMFS-PURREQNAPPRVLRANK5FEATUREDESC table field -
▼
Description: Field Name: PURREQNAPPRVLRANK5FEATUREDESC Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK5FEATUREDESC
|
CPURREQITEMFS-PURREQNAPPRVLRANK5FEATURE table field - Intelligent Approval Attribute 5
▼
Description: Intelligent Approval Attribute 5 Field Name: PURREQNAPPRVLRANK5FEATURE Data Element: MMPUR_ML_FEATURE_NAME5 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK5FEATURE
|
CPURREQITEMFS-PURREQNAPPRVLRANK5FEATUREVALUE table field - Value for Intelligent Approval Attribute 5
▼
Description: Value for Intelligent Approval Attribute 5 Field Name: PURREQNAPPRVLRANK5FEATUREVALUE Data Element: MMPUR_ML_FEATURE_VALUE5 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNAPPRVLRANK5FEATUREVALUE
|
CPURREQITEMFS-ISPURREQNOVRLREL table field - Overall release of purchase requisitions
▼
Description: Overall release of purchase requisitions Field Name: ISPURREQNOVRLREL Data Element: GSFRG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISPURREQNOVRLREL
|
CPURREQITEMFS-PROCUREMENTHUBSOURCESYSTEM table field - Connected System ID
▼
Description: Connected System ID Field Name: PROCUREMENTHUBSOURCESYSTEM Data Element: MMPUR_D_SOURCE_SYS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: MMPUR_REQ_SH_BE_SYS SHLP Field: BE_SOURCE_SYS ConvExit: See all SAP tables containing field PROCUREMENTHUBSOURCESYSTEM
|
CPURREQITEMFS-PURREQCREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: PURREQCREATIONDATE Data Element: BADAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQCREATIONDATE
|
CPURREQITEMFS-CREATEDBYUSERFULLNAME table field - Full Name of Person
▼
Description: Full Name of Person Field Name: CREATEDBYUSERFULLNAME Data Element: AD_NAMTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSERFULLNAME
|
CPURREQITEMFS-WORKFLOWTASKINTERNALID table field - Work item ID
▼
Description: Work item ID Field Name: WORKFLOWTASKINTERNALID Data Element: SWW_WIID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: WID AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKFLOWTASKINTERNALID
|
CPURREQITEMFS-EXPECTEDOVERALLLIMITAMOUNT table field - Expected Value of Overall Limit
▼
Description: Expected Value of Overall Limit Field Name: EXPECTEDOVERALLLIMITAMOUNT Data Element: COMMITMENT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EXPECTEDOVERALLLIMITAMOUNT
|
CPURREQITEMFS-OVERALLLIMITAMOUNT table field - Overall Limit
▼
Description: Overall Limit Field Name: OVERALLLIMITAMOUNT Data Element: SUMLIMIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OVERALLLIMITAMOUNT
|
CPURREQITEMFS-PURCHASEREQUISITIONRELEASEDATE table field - Purchase Requisition Release Date
▼
Description: Purchase Requisition Release Date Field Name: PURCHASEREQUISITIONRELEASEDATE Data Element: FRGDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURCHASEREQUISITIONRELEASEDATE
|
CPURREQITEMFS-PERFORMANCEPERIODSTARTDATE table field - Start Date for Period of Performance
▼
Description: Start Date for Period of Performance Field Name: PERFORMANCEPERIODSTARTDATE Data Element: MMPUR_SERVPROC_PERIOD_START Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERFORMANCEPERIODSTARTDATE
|
CPURREQITEMFS-PERFORMANCEPERIODENDDATE table field - End Date for Period of Performance
▼
Description: End Date for Period of Performance Field Name: PERFORMANCEPERIODENDDATE Data Element: MMPUR_SERVPROC_PERIOD_END Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERFORMANCEPERIODENDDATE
|
CPURREQITEMFS-ISONBEHALFCART table field - Shop on behalf indicator
▼
Description: Shop on behalf indicator Field Name: ISONBEHALFCART Data Element: MMPUR_REQ_D_SOB Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISONBEHALFCART
|
CPURREQITEMFS-WORKFLOWSCENARIODEFINITION table field -
▼
Description: Field Name: WORKFLOWSCENARIODEFINITION Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKFLOWSCENARIODEFINITION
|
CPURREQITEMFS-PURGHASFLXBLWORKFLOWAPPROVAL table field - Checkbox
▼
Description: Checkbox Field Name: PURGHASFLXBLWORKFLOWAPPROVAL Data Element: XFELD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURGHASFLXBLWORKFLOWAPPROVAL
|
CPURREQITEMFS-ISOUTLINE table field - Is Outline
▼
Description: Is Outline Field Name: ISOUTLINE Data Element: MMPUR_REQ_IS_OUTLINE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISOUTLINE
|
CPURREQITEMFS-HASRESTRICTEDVISIBILITY table field -
▼
Description: Field Name: HASRESTRICTEDVISIBILITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HASRESTRICTEDVISIBILITY
|
CPURREQITEMFS-PURGCONFIGURABLEITEMNUMBER table field - Hierarchy Number
▼
Description: Hierarchy Number Field Name: PURGCONFIGURABLEITEMNUMBER Data Element: EXLIN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURGCONFIGURABLEITEMNUMBER
|
CPURREQITEMFS-PURREQNHASDELEGATEAPPROVAL table field - Purchase Requisition in external approval
▼
Description: Purchase Requisition in external approval Field Name: PURREQNHASDELEGATEAPPROVAL Data Element: MMPUR_INDELEGATEAPPROVAL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PURREQNHASDELEGATEAPPROVAL
|
CPURREQITEMFS-CNTRLREQNISRPLDBFRAPPRVL table field - Is Replication Before Approval
▼
Description: Is Replication Before Approval Field Name: CNTRLREQNISRPLDBFRAPPRVL Data Element: MMPUR_PR_CEN_REQN_REPL_BFR_APP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNTRLREQNISRPLDBFRAPPRVL
|
CPURREQITEMFS-CNTRLREQNAPPRVLSTSINRPLDREQN table field - Approval Status of Purchase Requisition in Hub
▼
Description: Approval Status of Purchase Requisition in Hub Field Name: CNTRLREQNAPPRVLSTSINRPLDREQN Data Element: MMPUR_PR_CEN_REQN_APP_RPLD_PR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNTRLREQNAPPRVLSTSINRPLDREQN
|
CPURREQITEMFS-PRODUCTSEASONYEAR table field - Season Year
▼
Description: Season Year Field Name: PRODUCTSEASONYEAR Data Element: FSH_SAISJ Data Type: length (Dec): 0(0) Check table: FSH_SEASONS Conversion Routine: Domain Name: MemoryID: WMSAISJ AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTSEASONYEAR
|
CPURREQITEMFS-PRODUCTSEASON table field - Season
▼
Description: Season Field Name: PRODUCTSEASON Data Element: FSH_SAISO Data Type: length (Dec): 0(0) Check table: FSH_SEASONS Conversion Routine: Domain Name: MemoryID: SAISO AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTSEASON
|
CPURREQITEMFS-PRODUCTCOLLECTION table field - Fashion Collection
▼
Description: Fashion Collection Field Name: PRODUCTCOLLECTION Data Element: FSH_COLLECTION Data Type: CHAR length (Dec): 10(0) Check table: FSH_COLLECTIONS Conversion Routine: Domain Name: FSH_COLLECTION MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTCOLLECTION
|
CPURREQITEMFS-PRODUCTTHEME table field - Fashion Theme
▼
Description: Fashion Theme Field Name: PRODUCTTHEME Data Element: FSH_THEME Data Type: CHAR length (Dec): 10(0) Check table: FSH_THEMES Conversion Routine: Domain Name: FSH_THEME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTTHEME
|
CPURREQITEMFS-CROSSPLANTCONFIGURABLEPRODUCT table field - Cross-Plant Configurable Material
▼
Description: Cross-Plant Configurable Material Field Name: CROSSPLANTCONFIGURABLEPRODUCT Data Element: SATNR Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CROSSPLANTCONFIGURABLEPRODUCT
|
CPURREQITEMFS-PRODUCTCHARACTERISTIC1 table field - Characteristic Value for Colors of Variants
▼
Description: Characteristic Value for Colors of Variants Field Name: PRODUCTCHARACTERISTIC1 Data Element: WRF_COLOR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTCHARACTERISTIC1
|
CPURREQITEMFS-PRODUCTCHARACTERISTIC2 table field - Characteristic Value for Main Sizes of Variants
▼
Description: Characteristic Value for Main Sizes of Variants Field Name: PRODUCTCHARACTERISTIC2 Data Element: WRF_SIZE1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTCHARACTERISTIC2
|
CPURREQITEMFS-PRODUCTCHARACTERISTIC3 table field - Characteristic Value for Second Size for Variants
▼
Description: Characteristic Value for Second Size for Variants Field Name: PRODUCTCHARACTERISTIC3 Data Element: WRF_SIZE2 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTCHARACTERISTIC3
|
CPURREQITEMFS-STOCKSEGMENT table field - Stock Segment
▼
Description: Stock Segment Field Name: STOCKSEGMENT Data Element: SGT_SCAT Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: SGT_SRCA MemoryID: SGT_S AppClass: SHLP: SGT_CAT_FIELD_POPUP SHLP Field: VALUE ConvExit: See all SAP tables containing field STOCKSEGMENT
|