Details |
CPRDDCMRP-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CPRDDCMRP-PRODUCT table field - Material Number
▼
Description: Material Number Field Name: PRODUCT Data Element: MATNR Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field PRODUCT
|
CPRDDCMRP-PLANT table field - MRP Area: Plant
▼
Description: MRP Area: Plant Field Name: PLANT Data Element: WERKDP Data Type: length (Dec): 0(0) Check table: T001W Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANT
|
CPRDDCMRP-MRPAREA table field - MRP Area
▼
Description: MRP Area Field Name: MRPAREA Data Element: BERID Data Type: length (Dec): 0(0) Check table: MDLV Conversion Routine: Domain Name: MemoryID: BERID AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPAREA
|
CPRDDCMRP-PLANTFOREDIT table field - MRP Area: Plant
▼
Description: MRP Area: Plant Field Name: PLANTFOREDIT Data Element: WERKDP Data Type: length (Dec): 0(0) Check table: T001W Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANTFOREDIT
|
CPRDDCMRP-PRODUCTFOREDIT table field - Material Number
▼
Description: Material Number Field Name: PRODUCTFOREDIT Data Element: MATNR Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: MAT AppClass: SHLP: S_MAT1 SHLP Field: MATNR ConvExit: See all SAP tables containing field PRODUCTFOREDIT
|
CPRDDCMRP-MRPAREAFOREDIT table field - MRP Area
▼
Description: MRP Area Field Name: MRPAREAFOREDIT Data Element: BERID Data Type: length (Dec): 0(0) Check table: MDLV Conversion Routine: Domain Name: MemoryID: BERID AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPAREAFOREDIT
|
CPRDDCMRP-MRPTYPE table field - MRP Type
▼
Description: MRP Type Field Name: MRPTYPE Data Element: DISMM Data Type: length (Dec): 0(0) Check table: T438A Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPTYPE
|
CPRDDCMRP-MRPRESPONSIBLE table field - MRP Controller
▼
Description: MRP Controller Field Name: MRPRESPONSIBLE Data Element: DISPO Data Type: length (Dec): 0(0) Check table: T024D Conversion Routine: Domain Name: MemoryID: DGR AppClass: SHLP: HS_T024D SHLP Field: DISPO ConvExit: See all SAP tables containing field MRPRESPONSIBLE
|
CPRDDCMRP-REORDERTHRESHOLDQUANTITY table field - Reorder Point
▼
Description: Reorder Point Field Name: REORDERTHRESHOLDQUANTITY Data Element: MINBE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field REORDERTHRESHOLDQUANTITY
|
CPRDDCMRP-PLANANDORDERDAYDETERMINATION table field - Planning Cycle
▼
Description: Planning Cycle Field Name: PLANANDORDERDAYDETERMINATION Data Element: LFRHY Data Type: length (Dec): 0(0) Check table: T439G Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANANDORDERDAYDETERMINATION
|
CPRDDCMRP-PLANNINGTIMEFENCE table field - Planning time fence
▼
Description: Planning time fence Field Name: PLANNINGTIMEFENCE Data Element: FXHOR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANNINGTIMEFENCE
|
CPRDDCMRP-LOTSIZINGPROCEDURE table field - Lot Sizing Procedure in Materials Planning
▼
Description: Lot Sizing Procedure in Materials Planning Field Name: LOTSIZINGPROCEDURE Data Element: DISLS Data Type: length (Dec): 0(0) Check table: T439A Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LOTSIZINGPROCEDURE
|
CPRDDCMRP-LOTSIZEROUNDINGQUANTITY table field - Rounding value for purchase order quantity
▼
Description: Rounding value for purchase order quantity Field Name: LOTSIZEROUNDINGQUANTITY Data Element: BSTRF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LOTSIZEROUNDINGQUANTITY
|
CPRDDCMRP-MINIMUMLOTSIZEQUANTITY table field - Minimum Lot Size
▼
Description: Minimum Lot Size Field Name: MINIMUMLOTSIZEQUANTITY Data Element: BSTMI Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MINIMUMLOTSIZEQUANTITY
|
CPRDDCMRP-MAXIMUMLOTSIZEQUANTITY table field - Maximum Lot Size
▼
Description: Maximum Lot Size Field Name: MAXIMUMLOTSIZEQUANTITY Data Element: BSTMA Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAXIMUMLOTSIZEQUANTITY
|
CPRDDCMRP-MAXIMUMSTOCKQUANTITY table field - Maximum Stock Level
▼
Description: Maximum Stock Level Field Name: MAXIMUMSTOCKQUANTITY Data Element: MABST Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAXIMUMSTOCKQUANTITY
|
CPRDDCMRP-ASSEMBLYSCRAPPERCENT table field - Assembly scrap in percent
▼
Description: Assembly scrap in percent Field Name: ASSEMBLYSCRAPPERCENT Data Element: AUSSS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ASSEMBLYSCRAPPERCENT
|
CPRDDCMRP-PROCUREMENTSUBTYPE table field - Special Procurement Type
▼
Description: Special Procurement Type Field Name: PROCUREMENTSUBTYPE Data Element: SOBSL Data Type: length (Dec): 0(0) Check table: T460A Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROCUREMENTSUBTYPE
|
CPRDDCMRP-STORAGELOCATION table field - Issue Storage Location
▼
Description: Issue Storage Location Field Name: STORAGELOCATION Data Element: LGPRO Data Type: length (Dec): 0(0) Check table: MDLG Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STORAGELOCATION
|
CPRDDCMRP-DFLTSTORAGELOCATIONEXTPROCMT table field - Default Storage Location for External Procurement
▼
Description: Default Storage Location for External Procurement Field Name: DFLTSTORAGELOCATIONEXTPROCMT Data Element: LGFSB Data Type: length (Dec): 0(0) Check table: MDLG Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DFLTSTORAGELOCATIONEXTPROCMT
|
CPRDDCMRP-SAFETYSTOCKQUANTITY table field - Safety Stock
▼
Description: Safety Stock Field Name: SAFETYSTOCKQUANTITY Data Element: EISBE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SAFETYSTOCKQUANTITY
|
CPRDDCMRP-SAFETYDURATION table field - Safety Time (in Workdays)
▼
Description: Safety Time (in Workdays) Field Name: SAFETYDURATION Data Element: SHZET Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SAFETYDURATION
|
CPRDDCMRP-FIXEDLOTSIZEQUANTITY table field - Fixed lot size
▼
Description: Fixed lot size Field Name: FIXEDLOTSIZEQUANTITY Data Element: BSTFE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FIXEDLOTSIZEQUANTITY
|
CPRDDCMRP-ISMARKEDFORDELETION table field - Deletion Indicator
▼
Description: Deletion Indicator Field Name: ISMARKEDFORDELETION Data Element: LVORM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISMARKEDFORDELETION
|
CPRDDCMRP-MAINTENANCESTATUSNAME table field - Maintenance status
▼
Description: Maintenance status Field Name: MAINTENANCESTATUSNAME Data Element: PSTAT_D Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINTENANCESTATUSNAME
|
CPRDDCMRP-PLANNEDDELIVERYDURATIONINDAYS table field - Planned Delivery Time in Days
▼
Description: Planned Delivery Time in Days Field Name: PLANNEDDELIVERYDURATIONINDAYS Data Element: PLIFZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANNEDDELIVERYDURATIONINDAYS
|
CPRDDCMRP-MRPGROUP table field - MRP Group
▼
Description: MRP Group Field Name: MRPGROUP Data Element: DISGR Data Type: length (Dec): 0(0) Check table: T438M Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPGROUP
|
CPRDDCMRP-STORAGECOSTSPERCENTAGECODE table field - Storage Costs Percentage Code
▼
Description: Storage Costs Percentage Code Field Name: STORAGECOSTSPERCENTAGECODE Data Element: LAGPR Data Type: length (Dec): 0(0) Check table: T439L Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STORAGECOSTSPERCENTAGECODE
|
CPRDDCMRP-MRPPLANNINGCALENDAR table field - Planning Calendar
▼
Description: Planning Calendar Field Name: MRPPLANNINGCALENDAR Data Element: MRPPP Data Type: length (Dec): 0(0) Check table: T439G Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MRPPLANNINGCALENDAR
|
CPRDDCMRP-ROUNDINGPROFILE table field - Rounding Profile
▼
Description: Rounding Profile Field Name: ROUNDINGPROFILE Data Element: RDPRF Data Type: length (Dec): 0(0) Check table: RDPR Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ROUNDINGPROFILE
|
CPRDDCMRP-RANGEOFCVRGPRFLCODE table field - Range-of-Coverage Profile
▼
Description: Range-of-Coverage Profile Field Name: RANGEOFCVRGPRFLCODE Data Element: RWPRO Data Type: length (Dec): 0(0) Check table: T438R Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RANGEOFCVRGPRFLCODE
|
CPRDDCMRP-PRODUCTSAFETYTIMEMRPRELEVANCE table field - Safety Time Indicator (with or Without Safety Time)
▼
Description: Safety Time Indicator (with or Without Safety Time) Field Name: PRODUCTSAFETYTIMEMRPRELEVANCE Data Element: SHFLG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODUCTSAFETYTIMEMRPRELEVANCE
|
CPRDDCMRP-PERDPRFLFORSFTYTME table field - Period Profile for Safety Time
▼
Description: Period Profile for Safety Time Field Name: PERDPRFLFORSFTYTME Data Element: SHPRO Data Type: length (Dec): 0(0) Check table: T438V Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PERDPRFLFORSFTYTME
|
CPRDDCMRP-DEPENDENTRQMTMRPRELEVANCE table field - MRP relevancy for dependent requirements
▼
Description: MRP relevancy for dependent requirements Field Name: DEPENDENTRQMTMRPRELEVANCE Data Element: AHDIS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEPENDENTRQMTMRPRELEVANCE
|
CPRDDCMRP-ISPLANNEDDELIVERYTIME table field - Consider Planned Delivery Time of the MRP Area
▼
Description: Consider Planned Delivery Time of the MRP Area Field Name: ISPLANNEDDELIVERYTIME Data Element: ISPLANNEDDELIVERYTIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISPLANNEDDELIVERYTIME
|
CPRDDCMRP-LOTSIZEINDEPENDENTCOSTS table field - Lot-Size-Independent Costs
▼
Description: Lot-Size-Independent Costs Field Name: LOTSIZEINDEPENDENTCOSTS Data Element: LOSFX Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LOTSIZEINDEPENDENTCOSTS
|
CPRDDCMRP-RQMTQTYRCPTTAKTTMEINWRKGDAYS table field - Takt time
▼
Description: Takt time Field Name: RQMTQTYRCPTTAKTTMEINWRKGDAYS Data Element: TAKZT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RQMTQTYRCPTTAKTTMEINWRKGDAYS
|
CPRDDCMRP-SRVCLVL table field - Service level
▼
Description: Service level Field Name: SRVCLVL Data Element: LGRAD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SRVCLVL
|
CPRDDCMRP-BASEUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: BASEUNIT Data Element: MEINS Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BASEUNIT
|
CPRDDCMRP-CURRENCY table field - Currency Key
▼
Description: Currency Key Field Name: CURRENCY Data Element: WAERS Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: FWS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CURRENCY
|
CPRDDCMRP-ASSEMBLYSCRAPUNIT table field - Assembly Scrap Unit
▼
Description: Assembly Scrap Unit Field Name: ASSEMBLYSCRAPUNIT Data Element: ASSEMBLYSCRAPUNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ASSEMBLYSCRAPUNIT
|
CPRDDCMRP-SAFETYDURATIONUNIT table field - Safety Duration Unit
▼
Description: Safety Duration Unit Field Name: SAFETYDURATIONUNIT Data Element: SAFETYDURATIONUNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SAFETYDURATIONUNIT
|
CPRDDCMRP-SERVICELEVELUNIT table field - Service Level Unit
▼
Description: Service Level Unit Field Name: SERVICELEVELUNIT Data Element: SERVICELEVELUNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SERVICELEVELUNIT
|
CPRDDCMRP-PLANNEDDELIVERYDURATIONUNIT table field - Planned Delivery Time Unit
▼
Description: Planned Delivery Time Unit Field Name: PLANNEDDELIVERYDURATIONUNIT Data Element: PLANNEDDELIVERYDURATIONUNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANNEDDELIVERYDURATIONUNIT
|
CPRDDCMRP-PLANNINGTIMEFENCEUNIT table field - Planning Time Fence Unit
▼
Description: Planning Time Fence Unit Field Name: PLANNINGTIMEFENCEUNIT Data Element: PLANNINGTIMEFENCEUNIT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANNINGTIMEFENCEUNIT
|