Details |
CMMFDOR_S_ORDREQ-KEY table field - NodeID
▼
Description: NodeID Field Name: KEY Data Element: /BOBF/CONF_KEY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field KEY
|
CMMFDOR_S_ORDREQ-PARENT_KEY table field - NodeID
▼
Description: NodeID Field Name: PARENT_KEY Data Element: /BOBF/CONF_KEY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PARENT_KEY
|
CMMFDOR_S_ORDREQ-ROOT_KEY table field - NodeID
▼
Description: NodeID Field Name: ROOT_KEY Data Element: /BOBF/CONF_KEY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ROOT_KEY
|
CMMFDOR_S_ORDREQ-COMMODITYORDERREQUEST table field - Commodity Derivative Order Request ID
▼
Description: Commodity Derivative Order Request ID Field Name: COMMODITYORDERREQUEST Data Element: CMMFDOR_ORDERREQUESTID Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: CMMFDOR_ORDERREQUESTID MemoryID: CMMORD AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field COMMODITYORDERREQUEST
|
CMMFDOR_S_ORDREQ-CMMDTYORDERREQUESTREASON table field - Commodity Derivative Order Request Reason
▼
Description: Commodity Derivative Order Request Reason Field Name: CMMDTYORDERREQUESTREASON Data Element: CMMFDOR_ORDERREQUESTRSN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: CMMODR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTREASON
|
CMMFDOR_S_ORDREQ-CMMDTYORDERREQUESTSTATUS table field - Commodity Derivative Order Request Status
▼
Description: Commodity Derivative Order Request Status Field Name: CMMDTYORDERREQUESTSTATUS Data Element: CMMFDOR_ORDERREQUESTSTATUS Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: CMMFDOR_ORDERREQUESTSTATUS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTSTATUS
|
CMMFDOR_S_ORDREQ-STATUSCRITICALITY table field -
▼
Description: Field Name: STATUSCRITICALITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STATUSCRITICALITY
|
CMMFDOR_S_ORDREQ-COMMODITYORDREQSTATUSREASON table field - Order Request Status Reason
▼
Description: Order Request Status Reason Field Name: COMMODITYORDREQSTATUSREASON Data Element: CMMFDOR_ORDERREQUSTATUSREASON Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDREQSTATUSREASON
|
CMMFDOR_S_ORDREQ-CMMDTYORDERREQUESTSOURCE table field - Commodity Derivative Order Request Source
▼
Description: Commodity Derivative Order Request Source Field Name: CMMDTYORDERREQUESTSOURCE Data Element: CMMFDOR_CMMDTYORDREQUESTSOURCE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTSOURCE
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQSENTTOBRKRDATETIME table field - Commodity Derivative Order Request Sent to Broker Time Stamp
▼
Description: Commodity Derivative Order Request Sent to Broker Time Stamp Field Name: CMMDTYORDREQSENTTOBRKRDATETIME Data Element: CMMFDOR_ORDREQSENTTOBRKRDTETME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSENTTOBRKRDATETIME
|
CMMFDOR_S_ORDREQ-CMMDTYORDERREQUESTTYPE table field - Commodity Derivative Order Request Type
▼
Description: Commodity Derivative Order Request Type Field Name: CMMDTYORDERREQUESTTYPE Data Element: CMMFDOR_ORDERTYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: CMMODY AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTTYPE
|
CMMFDOR_S_ORDREQ-CMMDTYORDERREQUESTKIND table field - Commodity Derivative Order Kind
▼
Description: Commodity Derivative Order Kind Field Name: CMMDTYORDERREQUESTKIND Data Element: CMMFDOR_ORDERKIND Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTKIND
|
CMMFDOR_S_ORDREQ-CMMDTYORDERREQUESTKINDTEXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CMMDTYORDERREQUESTKINDTEXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTKINDTEXT
|
CMMFDOR_S_ORDREQ-CMMDTYORDFILLCOUNTERPARTYINFO table field - Commodity Derivative Counterparty Information
▼
Description: Commodity Derivative Counterparty Information Field Name: CMMDTYORDFILLCOUNTERPARTYINFO Data Element: CMMFDOR_COUNTERPARTYINFO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDFILLCOUNTERPARTYINFO
|
CMMFDOR_S_ORDREQ-CMMDTYDRVTVCOUNTERPARTYINFOTXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CMMDTYDRVTVCOUNTERPARTYINFOTXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVCOUNTERPARTYINFOTXT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQPRICINGPROGRAM table field - Commodity Derivative Order Request Pricing Program
▼
Description: Commodity Derivative Order Request Pricing Program Field Name: CMMDTYORDREQPRICINGPROGRAM Data Element: CMMFDOR_ORDREQPRICINGPROGRAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQPRICINGPROGRAM
|
CMMFDOR_S_ORDREQ-CMMDTYORDERREQUESTEXCHANGETYPE table field - Commodity Derivative Order Request Exchange Type
▼
Description: Commodity Derivative Order Request Exchange Type Field Name: CMMDTYORDERREQUESTEXCHANGETYPE Data Element: CMMFDOR_ORDREQEXCHANGETYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTEXCHANGETYPE
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQNEGTTNDATETIME table field - Commodity Derivative Order Request Negotiation Date Time
▼
Description: Commodity Derivative Order Request Negotiation Date Time Field Name: CMMDTYORDREQNEGTTNDATETIME Data Element: CMMFDOR_ORDNEGOTIATIONDATETIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQNEGTTNDATETIME
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQEXPRTNINSTRUCTION table field - Commodity Derivative Order Request Expiry Instruction
▼
Description: Commodity Derivative Order Request Expiry Instruction Field Name: CMMDTYORDREQEXPRTNINSTRUCTION Data Element: CMMFDOR_ORDEREXPIRATIONINST Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQEXPRTNINSTRUCTION
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQUESTEXPIRATIONDATE table field - Commodity Derivative Order Request Expiration Date
▼
Description: Commodity Derivative Order Request Expiration Date Field Name: CMMDTYORDREQUESTEXPIRATIONDATE Data Element: CMMFDOR_ORDREQEXPIRATIONDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQUESTEXPIRATIONDATE
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQUESTQUANTITYINLOT table field - Commodity Derivative Order Request Quantity in Lots
▼
Description: Commodity Derivative Order Request Quantity in Lots Field Name: CMMDTYORDREQUESTQUANTITYINLOT Data Element: CMMFDOR_ORDREQNUMBEROFLOTS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQUESTQUANTITYINLOT
|
CMMFDOR_S_ORDREQ-CMMDTYDERIVATIVEQUANTITYPERLOT table field - Derivative Contract Specification Quantity
▼
Description: Derivative Contract Specification Quantity Field Name: CMMDTYDERIVATIVEQUANTITYPERLOT Data Element: TBA_DCS_QNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDERIVATIVEQUANTITYPERLOT
|
CMMFDOR_S_ORDREQ-CMMDTYDRVTVQUANTITYUNITPERLOT table field - Derivative Contract Specification Unit of Measure
▼
Description: Derivative Contract Specification Unit of Measure Field Name: CMMDTYDRVTVQUANTITYUNITPERLOT Data Element: TBA_DCS_UOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVQUANTITYUNITPERLOT
|
CMMFDOR_S_ORDREQ-CMMDTYDERIVATIVECURRENCYPERLOT table field - Quotation Currency
▼
Description: Quotation Currency Field Name: CMMDTYDERIVATIVECURRENCYPERLOT Data Element: TBA_CURRENCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDERIVATIVECURRENCYPERLOT
|
CMMFDOR_S_ORDREQ-CMMDTYORDERREQUESTQUANTITY table field - Commodity Derivative Order Request Quantity For Filling
▼
Description: Commodity Derivative Order Request Quantity For Filling Field Name: CMMDTYORDERREQUESTQUANTITY Data Element: CMMFDOR_CMMDTYORDREQUESTQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTQUANTITY
|
CMMFDOR_S_ORDREQ-CMMDTYORDERREQUESTQUANTITYUNIT table field - Commodity Derivative Order Request Quantity For Filling UOM
▼
Description: Commodity Derivative Order Request Quantity For Filling UOM Field Name: CMMDTYORDERREQUESTQUANTITYUNIT Data Element: CMMFDOR_ORDREQUANTITYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTQUANTITYUNIT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQFILLEDQUANTITY table field - Commodity Derivative Order Request Filled Quantity
▼
Description: Commodity Derivative Order Request Filled Quantity Field Name: CMMDTYORDREQFILLEDQUANTITY Data Element: CMMFDOR_ORDREQFILLEDQUANTITY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQFILLEDQUANTITY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQFILLEDQUANTITYUNIT table field - Filled Quantity UoM of Derivative Order Request
▼
Description: Filled Quantity UoM of Derivative Order Request Field Name: CMMDTYORDREQFILLEDQUANTITYUNIT Data Element: CMMFDOR_ORDREQFILLEDQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQFILLEDQUANTITYUNIT
|
CMMFDOR_S_ORDREQ-CRITICALITYCODE table field -
▼
Description: Field Name: CRITICALITYCODE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CRITICALITYCODE
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQTOBEFILLEDQTY table field - Remaining quantity of order to be filled
▼
Description: Remaining quantity of order to be filled Field Name: CMMDTYORDREQTOBEFILLEDQTY Data Element: CMMFDOR_CMMDTYORDREQFILLTOQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOBEFILLEDQTY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQTOBEFILLEDQTYUNIT table field - Commodity Derivative Order Request Filled Quantity UOM
▼
Description: Commodity Derivative Order Request Filled Quantity UOM Field Name: CMMDTYORDREQTOBEFILLEDQTYUNIT Data Element: CMMFDOR_ORDREQTOBEFILLEDQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOBEFILLEDQTYUNIT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQTOBEFILLEDQTYTXT table field -
▼
Description: Field Name: CMMDTYORDREQTOBEFILLEDQTYTXT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOBEFILLEDQTYTXT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQTOPRICETOTQTY table field -
▼
Description: Field Name: CMMDTYORDREQTOPRICETOTQTY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOPRICETOTQTY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQTOPRICETOTQTYUNIT table field - Commodity Derivative Order Request Priced Quantity UOM
▼
Description: Commodity Derivative Order Request Priced Quantity UOM Field Name: CMMDTYORDREQTOPRICETOTQTYUNIT Data Element: CMMFDOR_ORDREQPRICEDQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOPRICETOTQTYUNIT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQPRICEDQUANTITY table field - Commodity Derivative Order Request Priced Quantity
▼
Description: Commodity Derivative Order Request Priced Quantity Field Name: CMMDTYORDREQPRICEDQUANTITY Data Element: CMMFDOR_ORDREQPRICEDQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQPRICEDQUANTITY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQPRICEDQUANTITYUNIT table field - Commodity Derivative Order Request Priced Quantity UOM
▼
Description: Commodity Derivative Order Request Priced Quantity UOM Field Name: CMMDTYORDREQPRICEDQUANTITYUNIT Data Element: CMMFDOR_ORDREQPRICEDQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQPRICEDQUANTITYUNIT
|
CMMFDOR_S_ORDREQ-CRITICALITY table field -
▼
Description: Field Name: CRITICALITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CRITICALITY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQTOBEPRICEDQTY table field - Commodity Order Request Total Quantity To Be Priced
▼
Description: Commodity Order Request Total Quantity To Be Priced Field Name: CMMDTYORDREQTOBEPRICEDQTY Data Element: CMMFDOR_CMMDTYORREQUESTOTPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOBEPRICEDQTY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQTOBEPRICEDQTYUNIT table field - Commodity Derivative Order Request Priced Quantity UOM
▼
Description: Commodity Derivative Order Request Priced Quantity UOM Field Name: CMMDTYORDREQTOBEPRICEDQTYUNIT Data Element: CMMFDOR_ORDREQTOBEPRICEDQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOBEPRICEDQTYUNIT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQTOBEPRICEDQTYTXT table field -
▼
Description: Field Name: CMMDTYORDREQTOBEPRICEDQTYTXT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOBEPRICEDQTYTXT
|
CMMFDOR_S_ORDREQ-CMMDTYORDERREQMSGISAVAILABLE table field -
▼
Description: Field Name: CMMDTYORDERREQMSGISAVAILABLE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQMSGISAVAILABLE
|
CMMFDOR_S_ORDREQ-NUMBEROFERRORMESSAGES table field -
▼
Description: Field Name: NUMBEROFERRORMESSAGES Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFERRORMESSAGES
|
CMMFDOR_S_ORDREQ-NUMBEROFWARNINGMESSAGES table field -
▼
Description: Field Name: NUMBEROFWARNINGMESSAGES Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFWARNINGMESSAGES
|
CMMFDOR_S_ORDREQ-CMMDTYDRVTVLASTMKTPRCPERQTYTXT table field - Commodity Order Request Last Known Market Price per Qty Text
▼
Description: Commodity Order Request Last Known Market Price per Qty Text Field Name: CMMDTYDRVTVLASTMKTPRCPERQTYTXT Data Element: CMMFDOR_LASTMKTPRCPERQTYTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVLASTMKTPRCPERQTYTXT
|
CMMFDOR_S_ORDREQ-CMMDTYDRVTVLASTMKTPRCUPDATEDON table field - Commodity Derivative Last Known Market Price Updated On
▼
Description: Commodity Derivative Last Known Market Price Updated On Field Name: CMMDTYDRVTVLASTMKTPRCUPDATEDON Data Element: CMMFDOR_LASTMKTPRCUPDATEDON Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVLASTMKTPRCUPDATEDON
|
CMMFDOR_S_ORDREQ-CMMDTYLASTSPREADVALPERQTYTXT table field - Commodity Order Request Requested Spread Value per Qty Text
▼
Description: Commodity Order Request Requested Spread Value per Qty Text Field Name: CMMDTYLASTSPREADVALPERQTYTXT Data Element: CMMFDOR_LASTSPREADVALPERQTYTXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYLASTSPREADVALPERQTYTXT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQPRCGEXECINSTRN table field - Commodity Order Request Pricing and Execution Instruction
▼
Description: Commodity Order Request Pricing and Execution Instruction Field Name: CMMDTYORDREQPRCGEXECINSTRN Data Element: CMMFDOR_ORDERPRICINGEXECINST Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQPRCGEXECINSTRN
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLMTPRC table field - Commodity Derivative Order Request Limit Price
▼
Description: Commodity Derivative Order Request Limit Price Field Name: CMMDTYORDREQLMTPRC Data Element: CMMFDOR_CMMDTYORDERREQLIMPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTPRC
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLMTPRCCURRENCY table field - Commodity Derivative Order Request Limit Price Currency
▼
Description: Commodity Derivative Order Request Limit Price Currency Field Name: CMMDTYORDREQLMTPRCCURRENCY Data Element: CMMFDOR_ORDREQLIMITPRICECRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTPRCCURRENCY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLMTPRCQUANTITY table field - Commodity Derivative Order Request Limit Price Quantity
▼
Description: Commodity Derivative Order Request Limit Price Quantity Field Name: CMMDTYORDREQLMTPRCQUANTITY Data Element: CMMFDOR_ORDREQLIMITPRICEQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTPRCQUANTITY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLMTPRCQUANTITYUNIT table field - Limit Price Quantity UoM of Order Request
▼
Description: Limit Price Quantity UoM of Order Request Field Name: CMMDTYORDREQLMTPRCQUANTITYUNIT Data Element: CMMFDOR_ORDREQLIMITPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTPRCQUANTITYUNIT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLMTSPREADPRC table field - Commodity Derivative Order Request Limit Spread Value
▼
Description: Commodity Derivative Order Request Limit Spread Value Field Name: CMMDTYORDREQLMTSPREADPRC Data Element: CMMFDOR_ORDREQLMTSPREADPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTSPREADPRC
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLMTSPREADPRCCRCY table field - Commodity Order Request Limit Spread Price Currency
▼
Description: Commodity Order Request Limit Spread Price Currency Field Name: CMMDTYORDREQLMTSPREADPRCCRCY Data Element: CMMFDOR_ORDREQLMTSPREADPRCCRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTSPREADPRCCRCY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLMTSPREADPRCQTY table field - Limit Spread Price Quantity of Order Request
▼
Description: Limit Spread Price Quantity of Order Request Field Name: CMMDTYORDREQLMTSPREADPRCQTY Data Element: CMMFDOR_ORDREQLMTSPREADPRCQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTSPREADPRCQTY
|
CMMFDOR_S_ORDREQ-CMMDTYORDLMTSPREADPRCQTYUNIT table field - Commodity Order Request Limit Spread Price Quantity Unit
▼
Description: Commodity Order Request Limit Spread Price Quantity Unit Field Name: CMMDTYORDLMTSPREADPRCQTYUNIT Data Element: CMMFDOR_ORDREQLMTSPRDPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDLMTSPREADPRCQTYUNIT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQSTOPPRICE table field - Commodity Derivative Order Request Stop Price
▼
Description: Commodity Derivative Order Request Stop Price Field Name: CMMDTYORDREQSTOPPRICE Data Element: CMMFDOR_ORDREQSTOPPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPPRICE
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQSTOPPRICECRCY table field - Commodity Derivative Order Request Stop Price Currency
▼
Description: Commodity Derivative Order Request Stop Price Currency Field Name: CMMDTYORDREQSTOPPRICECRCY Data Element: CMMFDOR_ORDREQSTOPPRICECRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPPRICECRCY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQSTOPPRICEQTY table field - Commodity Derivative Order Request Stop Price Quantity
▼
Description: Commodity Derivative Order Request Stop Price Quantity Field Name: CMMDTYORDREQSTOPPRICEQTY Data Element: CMMFDOR_ORDREQSTOPPRICEQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPPRICEQTY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQSTOPPRICEQTYUNIT table field - Stop Price Quantity Unit of Measurement of Order Request
▼
Description: Stop Price Quantity Unit of Measurement of Order Request Field Name: CMMDTYORDREQSTOPPRICEQTYUNIT Data Element: CMMFDOR_ORDREQSTOPPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPPRICEQTYUNIT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQFXDPRC table field - Commodity Derivative Order Request Requested Price
▼
Description: Commodity Derivative Order Request Requested Price Field Name: CMMDTYORDREQFXDPRC Data Element: CMMFDOR_ORDREQFIXEDPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQFXDPRC
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQFXDPRCCRCY table field - Commodity Derivative Order Request Requested Price Currency
▼
Description: Commodity Derivative Order Request Requested Price Currency Field Name: CMMDTYORDREQFXDPRCCRCY Data Element: CMMFDOR_ORDREQFIXEDPRICECRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQFXDPRCCRCY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQFXDPRCQTY table field - Commodity Derivative Order Request Requested Price Quantity
▼
Description: Commodity Derivative Order Request Requested Price Quantity Field Name: CMMDTYORDREQFXDPRCQTY Data Element: CMMFDOR_ORDREQFIXEDPRICEQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQFXDPRCQTY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQFXDPRCQTYUNIT table field - Commodity Order Request Requested Price Quantity Unit
▼
Description: Commodity Order Request Requested Price Quantity Unit Field Name: CMMDTYORDREQFXDPRCQTYUNIT Data Element: CMMFDOR_ORDREQFIXEDPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQFXDPRCQTYUNIT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQFXDSPREADPRC table field - Commodity Derivative Order Request Requested Spread Price
▼
Description: Commodity Derivative Order Request Requested Spread Price Field Name: CMMDTYORDREQFXDSPREADPRC Data Element: CMMFDOR_ORDREQFIXEDSPREADPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQFXDSPREADPRC
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQFXDSPREADPRCCRCY table field - Commodity Derivative Order Requested Spread Price Currency
▼
Description: Commodity Derivative Order Requested Spread Price Currency Field Name: CMMDTYORDREQFXDSPREADPRCCRCY Data Element: CMMFDOR_ORDREQFXDSPREADPRCCRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQFXDSPREADPRCCRCY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQFXDSPREADPRCQTY table field - Commodity Derivative Order Requested Spread Price Quantity
▼
Description: Commodity Derivative Order Requested Spread Price Quantity Field Name: CMMDTYORDREQFXDSPREADPRCQTY Data Element: CMMFDOR_ORDREQFXDSPREADPRCQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQFXDSPREADPRCQTY
|
CMMFDOR_S_ORDREQ-CMMDTYORDFXDSPREADPRCQTYUNIT table field - Commodity Order Requested Spread Price Quantity Unit
▼
Description: Commodity Order Requested Spread Price Quantity Unit Field Name: CMMDTYORDFXDSPREADPRCQTYUNIT Data Element: CMMFDOR_ORDREQFXDSPRDPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDFXDSPREADPRCQTYUNIT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLEEWAYPRC table field - Commodity Derivative Order Request Requested Price
▼
Description: Commodity Derivative Order Request Requested Price Field Name: CMMDTYORDREQLEEWAYPRC Data Element: CMMFDOR_ORDREQLEEWAYPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYPRC
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLEEWAYPRCCRCY table field - Commodity Derivative Order Request Requested Price Currency
▼
Description: Commodity Derivative Order Request Requested Price Currency Field Name: CMMDTYORDREQLEEWAYPRCCRCY Data Element: CMMFDOR_ORDREQLEEWAYPRICECRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYPRCCRCY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLEEWAYPRCQTY table field - Commodity Derivative Order Request Requested Price Quantity
▼
Description: Commodity Derivative Order Request Requested Price Quantity Field Name: CMMDTYORDREQLEEWAYPRCQTY Data Element: CMMFDOR_ORDREQLEEWAYPRICEQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYPRCQTY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLEEWAYPRCQTYUNIT table field - Commodity Order Request Requested Price Quantity Unit
▼
Description: Commodity Order Request Requested Price Quantity Unit Field Name: CMMDTYORDREQLEEWAYPRCQTYUNIT Data Element: CMMFDOR_ORDREQLEEWAYPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYPRCQTYUNIT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLEEWAYRNGEPRC table field - Commodity Derivative Order Request Leeway Price
▼
Description: Commodity Derivative Order Request Leeway Price Field Name: CMMDTYORDREQLEEWAYRNGEPRC Data Element: CMMFDOR_ORDREQLEEWAYRNGEPRC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYRNGEPRC
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLEEWAYRNGEPRCCRCY table field - Cmmdty Derivative Order Request Leeway Price Currency
▼
Description: Cmmdty Derivative Order Request Leeway Price Currency Field Name: CMMDTYORDREQLEEWAYRNGEPRCCRCY Data Element: CMMFDOR_ORDREQLEEWAYRNGEPRCCUR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYRNGEPRCCRCY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQLEEWAYRNGEPRCQTY table field - Cmmdty Derivative Order Request Leeway Range Price Quantity
▼
Description: Cmmdty Derivative Order Request Leeway Range Price Quantity Field Name: CMMDTYORDREQLEEWAYRNGEPRCQTY Data Element: CMMFDOR_ORDREQLEEWAYRNGEPRCQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYRNGEPRCQTY
|
CMMFDOR_S_ORDREQ-CMMDTYORDLEEWAYRNGEPRCQTYUNIT table field - Cmmdty Derivative Order Request Leeway Price Qty Unit
▼
Description: Cmmdty Derivative Order Request Leeway Price Qty Unit Field Name: CMMDTYORDLEEWAYRNGEPRCQTYUNIT Data Element: CMMFDOR_ORDREQLWAYRNGPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDLEEWAYRNGEPRCQTYUNIT
|
CMMFDOR_S_ORDREQ-COMMODITYSUBACCOUNT table field - Commodity Subaccount ID
▼
Description: Commodity Subaccount ID Field Name: COMMODITYSUBACCOUNT Data Element: CMMFDOR_ASSIGNEDSUBACCOUNT Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: CMMFSA_SUBACCOUNTID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field COMMODITYSUBACCOUNT
|
CMMFDOR_S_ORDREQ-COMMODITYSUBACCOUNTUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: COMMODITYSUBACCOUNTUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYSUBACCOUNTUUID
|
CMMFDOR_S_ORDREQ-COMMODITYSUBACCOUNTNAME table field - Commodity Subaccount Name
▼
Description: Commodity Subaccount Name Field Name: COMMODITYSUBACCOUNTNAME Data Element: CMMFSA_SUBACCOUNTNAME Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: CMMFSA_SUBACCOUNTNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYSUBACCOUNTNAME
|
CMMFDOR_S_ORDREQ-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
CMMFDOR_S_ORDREQ-COMMODITYDERIVATIVEBROKER table field - Commodity Derivative Broker
▼
Description: Commodity Derivative Broker Field Name: COMMODITYDERIVATIVEBROKER Data Element: CMMFDOR_BROKER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYDERIVATIVEBROKER
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQCNTRPTYSUBACCT table field - Commodity Order Request Counterparty Subaccount
▼
Description: Commodity Order Request Counterparty Subaccount Field Name: CMMDTYORDREQCNTRPTYSUBACCT Data Element: CMMFDOR_ORDREQCNTRPTYSUBACCT Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: CMMFSA_SUBACCOUNTID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field CMMDTYORDREQCNTRPTYSUBACCT
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQCNTRPTYSUBACCTUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: CMMDTYORDREQCNTRPTYSUBACCTUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQCNTRPTYSUBACCTUUID
|
CMMFDOR_S_ORDREQ-COUNTERPARTY table field - Counterparty Number
▼
Description: Counterparty Number Field Name: COUNTERPARTY Data Element: RKONTRAH_NEW Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BPA AppClass: SHLP: BUPA SHLP Field: PARTNER ConvExit: See all SAP tables containing field COUNTERPARTY
|
CMMFDOR_S_ORDREQ-CMMDTYORDREQCNTRPTYBROKER table field - Counterparty Broker
▼
Description: Counterparty Broker Field Name: CMMDTYORDREQCNTRPTYBROKER Data Element: CMMFDOR_CNTRPARTY_BROKER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQCNTRPTYBROKER
|
CMMFDOR_S_ORDREQ-CMMDTYORDCNTRPTYBROKERREFACCT table field - Cmmdty Order Request Counterparty Broker Reference Account
▼
Description: Cmmdty Order Request Counterparty Broker Reference Account Field Name: CMMDTYORDCNTRPTYBROKERREFACCT Data Element: CMMFDOR_CNTRPTYBROKERREFACCT Data Type: CHAR length (Dec): 80(0) Check table: Conversion Routine: ALPHA Domain Name: CMMFSA_REFERENCEBROKERACCOUNT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field CMMDTYORDCNTRPTYBROKERREFACCT
|
CMMFDOR_S_ORDREQ-CREATEDBYUSER table field - Created By User
▼
Description: Created By User Field Name: CREATEDBYUSER Data Element: CMMFDOR_CREATEDBY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
CMMFDOR_S_ORDREQ-CREATEDBYUSERNAME table field - Created by user name
▼
Description: Created by user name Field Name: CREATEDBYUSERNAME Data Element: CMMFSA_CREATEDBYUSERNAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSERNAME
|
CMMFDOR_S_ORDREQ-CREATIONDATETIME table field - Timestamp of record creation
▼
Description: Timestamp of record creation Field Name: CREATIONDATETIME Data Element: CMMFDOR_CREATIONDATETIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATETIME
|
CMMFDOR_S_ORDREQ-LASTCHANGEDBYUSER table field - Last changed by user ID
▼
Description: Last changed by user ID Field Name: LASTCHANGEDBYUSER Data Element: CMMFDOR_LASTCHANGEDBYUSER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDBYUSER
|
CMMFDOR_S_ORDREQ-LASTCHANGEDBYUSERNAME table field - Last changed by user name
▼
Description: Last changed by user name Field Name: LASTCHANGEDBYUSERNAME Data Element: CMMFSA_LASTCHANGEDBYUSERNAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDBYUSERNAME
|
CMMFDOR_S_ORDREQ-LASTCHANGEDATETIME table field - Timestamp of last change
▼
Description: Timestamp of last change Field Name: LASTCHANGEDATETIME Data Element: CMMFDOR_LASTCHANGEDATETIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDATETIME
|
CMMFDOR_S_ORDREQ-ACTIVEUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: ACTIVEUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTIVEUUID
|
CMMFDOR_S_ORDREQ-HASACTIVEENTITY table field - Draft - Indicator - Has active document
▼
Description: Draft - Indicator - Has active document Field Name: HASACTIVEENTITY Data Element: SDRAFT_HAS_ACTIVE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HASACTIVEENTITY
|
CMMFDOR_S_ORDREQ-DRAFTENTITYCREATIONDATETIME table field - Draft Created On
▼
Description: Draft Created On Field Name: DRAFTENTITYCREATIONDATETIME Data Element: SDRAFT_CREATED_AT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DRAFTENTITYCREATIONDATETIME
|
CMMFDOR_S_ORDREQ-DRAFTENTITYLASTCHANGEDATETIME table field - Draft Last Changed On
▼
Description: Draft Last Changed On Field Name: DRAFTENTITYLASTCHANGEDATETIME Data Element: SDRAFT_LAST_CHANGED_AT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DRAFTENTITYLASTCHANGEDATETIME
|
CMMFDOR_S_ORDREQ-DRAFTENTITYCONSISTENCYSTATUS table field - Draft - Consistency Status
▼
Description: Draft - Consistency Status Field Name: DRAFTENTITYCONSISTENCYSTATUS Data Element: SDRAFT_CONSISTENCY_STATUS Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SDRAFT_CONSISTENCY_STATUS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DRAFTENTITYCONSISTENCYSTATUS
|
CMMFDOR_S_ORDREQ-DUMMY_SUBACCOUNTEXTN table field - Custom Fields: Dummy for Use in Extension Includes
▼
Description: Custom Fields: Dummy for Use in Extension Includes Field Name: DUMMY_SUBACCOUNTEXTN Data Element: CFD_DUMMY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DUMMY_SUBACCOUNTEXTN
|
CMMFDOR_S_ORDREQ-ISACTIVEENTITY table field - Draft - Indicator - Is active document
▼
Description: Draft - Indicator - Is active document Field Name: ISACTIVEENTITY Data Element: SDRAFT_IS_ACTIVE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISACTIVEENTITY
|