Details |
CDEFECTKEYFIG-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CDEFECTKEYFIG-DEFECTINTERNALID table field - Internal Defect ID
▼
Description: Internal Defect ID Field Name: DEFECTINTERNALID Data Element: QDEFECTINTERNALID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEFECTINTERNALID
|
CDEFECTKEYFIG-INSPECTIONLOT table field - Inspection Lot Number
▼
Description: Inspection Lot Number Field Name: INSPECTIONLOT Data Element: QPLOS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: QLS AppClass: SHLP: QALS SHLP Field: PRUEFLOS ConvExit: See all SAP tables containing field INSPECTIONLOT
|
CDEFECTKEYFIG-DEFECTCATEGORYTEXT table field - Defect Category Text
▼
Description: Defect Category Text Field Name: DEFECTCATEGORYTEXT Data Element: QDEFCATEGORYTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEFECTCATEGORYTEXT
|
CDEFECTKEYFIG-DEFECTCATEGORY table field - Defect Category
▼
Description: Defect Category Field Name: DEFECTCATEGORY Data Element: QDEFCATEGORY Data Type: length (Dec): 0(0) Check table: TQDEFCAT Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: QDEFCATEGORY SHLP Field: DEFECTCATEGORY ConvExit: See all SAP tables containing field DEFECTCATEGORY
|
CDEFECTKEYFIG-CREATIONDATE table field - Record Created On
▼
Description: Record Created On Field Name: CREATIONDATE Data Element: ERDAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATE
|
CDEFECTKEYFIG-CALENDARYEAR table field - Calendar Year
▼
Description: Calendar Year Field Name: CALENDARYEAR Data Element: CALENDARYEAR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CALENDARYEAR
|
CDEFECTKEYFIG-CALENDARQUARTER table field - Calendar Quarter
▼
Description: Calendar Quarter Field Name: CALENDARQUARTER Data Element: CALENDARQUARTER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CALENDARQUARTER
|
CDEFECTKEYFIG-CALENDARQUARTERNAME table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CALENDARQUARTERNAME Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CALENDARQUARTERNAME
|
CDEFECTKEYFIG-CALENDARMONTH table field - Calendar Month
▼
Description: Calendar Month Field Name: CALENDARMONTH Data Element: CALENDARMONTH Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CALENDARMONTH
|
CDEFECTKEYFIG-CALENDARMONTHNAME table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CALENDARMONTHNAME Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CALENDARMONTHNAME
|
CDEFECTKEYFIG-CALENDARWEEK table field - Calendar Week
▼
Description: Calendar Week Field Name: CALENDARWEEK Data Element: CALENDARWEEK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CALENDARWEEK
|
CDEFECTKEYFIG-DEFECTCODETEXT table field - Text for Defect Code
▼
Description: Text for Defect Code Field Name: DEFECTCODETEXT Data Element: VDM_QFECOD_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEFECTCODETEXT
|
CDEFECTKEYFIG-DEFECTCODE table field - Defect Code
▼
Description: Defect Code Field Name: DEFECTCODE Data Element: VDM_QFECOD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEFECTCODE
|
CDEFECTKEYFIG-DEFECTCODEGROUPTEXT table field - Text for Defect Code Group
▼
Description: Text for Defect Code Group Field Name: DEFECTCODEGROUPTEXT Data Element: VDM_QFEGRP_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEFECTCODEGROUPTEXT
|
CDEFECTKEYFIG-DEFECTLIFECYCLESTATUS table field - Defect Status
▼
Description: Defect Status Field Name: DEFECTLIFECYCLESTATUS Data Element: QDEFLCYCLESTAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEFECTLIFECYCLESTATUS
|
CDEFECTKEYFIG-DEFECTCODEGROUP table field - Defect Code Group
▼
Description: Defect Code Group Field Name: DEFECTCODEGROUP Data Element: VDM_QFEGRP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DEFECTCODEGROUP
|
CDEFECTKEYFIG-WORKCENTERTEXT table field - Work Center Text
▼
Description: Work Center Text Field Name: WORKCENTERTEXT Data Element: WORKCENTERTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKCENTERTEXT
|
CDEFECTKEYFIG-WORKCENTER table field - Work Center
▼
Description: Work Center Field Name: WORKCENTER Data Element: PPH_ARBPL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AGR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKCENTER
|
CDEFECTKEYFIG-PLANTNAME table field - Plant Name
▼
Description: Plant Name Field Name: PLANTNAME Data Element: WERKS_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANTNAME
|
CDEFECTKEYFIG-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: length (Dec): 0(0) Check table: T001W Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
|
CDEFECTKEYFIG-SUPPLIERNAME table field - Name of Supplier
▼
Description: Name of Supplier Field Name: SUPPLIERNAME Data Element: MD_SUPPLIER_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLIERNAME
|
CDEFECTKEYFIG-SUPPLIER table field - Supplier's Account Number
▼
Description: Supplier's Account Number Field Name: SUPPLIER Data Element: ELIFN Data Type: length (Dec): 0(0) Check table: LFA1 Conversion Routine: Domain Name: MemoryID: LIF AppClass: SHLP: KRED_C SHLP Field: LIFNR ConvExit: See all SAP tables containing field SUPPLIER
|
CDEFECTKEYFIG-MATERIALNAME table field - Material Description
▼
Description: Material Description Field Name: MATERIALNAME Data Element: MAKTX Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALNAME
|
CDEFECTKEYFIG-MATERIAL table field - Defective Material
▼
Description: Defective Material Field Name: MATERIAL Data Element: VDM_DEFECTIVE_MATERIAL Data Type: length (Dec): 0(0) Check table: MARA Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIAL
|
CDEFECTKEYFIG-CUSTOMERFULLNAME table field - Customer Full Name
▼
Description: Customer Full Name Field Name: CUSTOMERFULLNAME Data Element: MD_CUSTOMER_FULL_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMERFULLNAME
|
CDEFECTKEYFIG-CUSTOMER table field - Customer (Ship-to Party)
▼
Description: Customer (Ship-to Party) Field Name: CUSTOMER Data Element: VDM_QKUNWE Data Type: length (Dec): 0(0) Check table: KNA1 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CUSTOMER
|
CDEFECTKEYFIG-INSPRESULTHISTORYCHARC table field - Inspection Characteristic Key for Results History
▼
Description: Inspection Characteristic Key for Results History Field Name: INSPRESULTHISTORYCHARC Data Element: QM_INSPRESAGGR_CHARKEY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRESULTHISTORYCHARC
|
CDEFECTKEYFIG-INSPECTIONCHARACTERISTICTEXT table field - Short Text for Inspection Characteristic
▼
Description: Short Text for Inspection Characteristic Field Name: INSPECTIONCHARACTERISTICTEXT Data Element: VDM_QMKKURZTXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONCHARACTERISTICTEXT
|
CDEFECTKEYFIG-MASTERINSPCHARCSKEY table field - Master Inspection Characteristic
▼
Description: Master Inspection Characteristic Field Name: MASTERINSPCHARCSKEY Data Element: VDM_QMSTRINSPCHARCS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MASTERINSPCHARCSKEY
|
CDEFECTKEYFIG-INSPECTIONSPECIFICATIONTEXT table field - Text of Master Inspection Characteristic
▼
Description: Text of Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONTEXT Data Element: VDM_QMERKNR_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONTEXT
|
CDEFECTKEYFIG-NUMBEROFDEFECTS table field - Defects
▼
Description: Defects Field Name: NUMBEROFDEFECTS Data Element: VDM_NUMBEROFDEFECTS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFDEFECTS
|
CDEFECTKEYFIG-NUMBEROFDEFECTSWITHNOTIF table field - No. of Defect Records with Notification
▼
Description: No. of Defect Records with Notification Field Name: NUMBEROFDEFECTSWITHNOTIF Data Element: VDM_DEFECTRECDWTHNOTIFCNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFDEFECTSWITHNOTIF
|
CDEFECTKEYFIG-NUMBEROFDEFECTSWITHOUTNOTIF table field - No. of Defect Records Without Notification
▼
Description: No. of Defect Records Without Notification Field Name: NUMBEROFDEFECTSWITHOUTNOTIF Data Element: VDM_DEFECTRECDWTHOUTNOTIFCNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFDEFECTSWITHOUTNOTIF
|
CDEFECTKEYFIG-INSPECTIONLOTORIGIN table field - Inspection Lot Origin
▼
Description: Inspection Lot Origin Field Name: INSPECTIONLOTORIGIN Data Element: VDM_QHERK Data Type: length (Dec): 0(0) Check table: TQ31 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONLOTORIGIN
|
CDEFECTKEYFIG-INSPECTIONLOTTYPE table field - Inspection Type
▼
Description: Inspection Type Field Name: INSPECTIONLOTTYPE Data Element: QPART Data Type: length (Dec): 0(0) Check table: TQ30 Conversion Routine: Domain Name: MemoryID: QLA AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONLOTTYPE
|
CDEFECTKEYFIG-INSPECTIONCHARACTERISTIC table field - Inspection Characteristic Number
▼
Description: Inspection Characteristic Number Field Name: INSPECTIONCHARACTERISTIC Data Element: QMERKNRP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: QCHAR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONCHARACTERISTIC
|
CDEFECTKEYFIG-INSPECTIONSPECIFICATION table field - Master Inspection Characteristic
▼
Description: Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATION Data Element: QMERKNR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: PMK AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATION
|
CDEFECTKEYFIG-NOTIFICATION table field - Notification Number
▼
Description: Notification Number Field Name: NOTIFICATION Data Element: QMNUM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: IQM AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NOTIFICATION
|
CDEFECTKEYFIG-NOTIFICATIONITEM table field - Item Number in Item Record
▼
Description: Item Number in Item Record Field Name: NOTIFICATIONITEM Data Element: FELFD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NOTIFICATIONITEM
|
CDEFECTKEYFIG-MAINWORKCENTERINTERNALID table field - Object ID of the Work Center
▼
Description: Object ID of the Work Center Field Name: MAINWORKCENTERINTERNALID Data Element: LGWID Data Type: length (Dec): 0(0) Check table: CRID Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINWORKCENTERINTERNALID
|
CDEFECTKEYFIG-WORKCENTERPLANT table field - Work Center Plant
▼
Description: Work Center Plant Field Name: WORKCENTERPLANT Data Element: VDM_POPLATZWRK Data Type: length (Dec): 0(0) Check table: T001W Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKCENTERPLANT
|
CDEFECTKEYFIG-WORKCENTERPLANTNAME table field - Plant Name
▼
Description: Plant Name Field Name: WORKCENTERPLANTNAME Data Element: WERKS_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKCENTERPLANTNAME
|
CDEFECTKEYFIG-MATLQUALITYAUTHORIZATIONGROUP table field - Material Authorization Group for Activities in QM
▼
Description: Material Authorization Group for Activities in QM Field Name: MATLQUALITYAUTHORIZATIONGROUP Data Element: VDM_QMATAUTH Data Type: length (Dec): 0(0) Check table: TQ01B Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATLQUALITYAUTHORIZATIONGROUP
|
CDEFECTKEYFIG-ISBUSINESSPURPOSECOMPLETED table field - Business Purpose Completed Flag
▼
Description: Business Purpose Completed Flag Field Name: ISBUSINESSPURPOSECOMPLETED Data Element: CVP_XBLCK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CVP_XBLCK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISBUSINESSPURPOSECOMPLETED
|
CDEFECTKEYFIG-MAINWORKCENTER table field - Work Center
▼
Description: Work Center Field Name: MAINWORKCENTER Data Element: PPH_ARBPL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AGR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINWORKCENTER
|
CDEFECTKEYFIG-MAINWORKCENTERPLANT table field - Plant for Work Center
▼
Description: Plant for Work Center Field Name: MAINWORKCENTERPLANT Data Element: QARBPWERKS Data Type: length (Dec): 0(0) Check table: T001W Conversion Routine: Domain Name: MemoryID: WRK AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MAINWORKCENTERPLANT
|
CDEFECTKEYFIG-WORKCENTERTYPECODE table field - Object types of the CIM resource
▼
Description: Object types of the CIM resource Field Name: WORKCENTERTYPECODE Data Element: CR_OBJTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKCENTERTYPECODE
|
CDEFECTKEYFIG-INSPECTIONSPECIFICATIONPLANT table field - Plant for Master Inspection Characteristic
▼
Description: Plant for Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONPLANT Data Element: VDM_QPMK_WERKS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONPLANT
|
CDEFECTKEYFIG-INSPECTIONSPECIFICATIONVERSION table field - Version Number of Master Inspection Characteristic
▼
Description: Version Number of Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONVERSION Data Element: QVERSNRMK Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONVERSION
|