Details |
CCRRFAMTP-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CCRRFAMTP-CMPLRQRSLTUUID table field - Compliance Assessment UUID
▼
Description: Compliance Assessment UUID Field Name: CMPLRQRSLTUUID Data Element: EHFND_CRR_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQRSLTUUID
|
CCRRFAMTP-ACTIVECMPLRQRSLTUUID table field - Compliance Assessment UUID
▼
Description: Compliance Assessment UUID Field Name: ACTIVECMPLRQRSLTUUID Data Element: EHFND_CRR_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTIVECMPLRQRSLTUUID
|
CCRRFAMTP-CMPLRQVERSUUID table field - Compliance Requirement UUID
▼
Description: Compliance Requirement UUID Field Name: CMPLRQVERSUUID Data Element: EHFND_CRV_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQVERSUUID
|
CCRRFAMTP-CHMLCMPLNCINFOUUID table field - Chemical Compliance Information
▼
Description: Chemical Compliance Information Field Name: CHMLCMPLNCINFOUUID Data Element: EHFND_CCI_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFOUUID
|
CCRRFAMTP-CHMLSUPLRMATLUUID table field - Supplier Raw Material
▼
Description: Supplier Raw Material Field Name: CHMLSUPLRMATLUUID Data Element: EHFND_CSM_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLSUPLRMATLUUID
|
CCRRFAMTP-COMPLIANCEREQUIREMENT table field - Compliance Requirement
▼
Description: Compliance Requirement Field Name: COMPLIANCEREQUIREMENT Data Element: EHFND_REQ_IDENTIFIER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: EHFND_ELM_REQ_IDENTIFIER SHLP Field: COMPLIANCEREQUIREMENT ConvExit: See all SAP tables containing field COMPLIANCEREQUIREMENT
|
CCRRFAMTP-CMPLRQRSLTMANUALSTATUS table field - Manually Set Status of a Compliance Requirement
▼
Description: Manually Set Status of a Compliance Requirement Field Name: CMPLRQRSLTMANUALSTATUS Data Element: EHFND_CRR_MAN_STAT_ND Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQRSLTMANUALSTATUS
|
CCRRFAMTP-PROCESSOR table field - Processor
▼
Description: Processor Field Name: PROCESSOR Data Element: EHFND_CRR_PROCESSING_USER_BP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PROCESSOR
|
CCRRFAMTP-CMPLRQRSLTPROCESSORNAME table field - Full Name of Person
▼
Description: Full Name of Person Field Name: CMPLRQRSLTPROCESSORNAME Data Element: AD_NAMTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQRSLTPROCESSORNAME
|
CCRRFAMTP-RELEASEDBYUSER table field - Released By
▼
Description: Released By Field Name: RELEASEDBYUSER Data Element: EHFND_CRR_RELEASED_BY_USER_BP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RELEASEDBYUSER
|
CCRRFAMTP-RELEASEDBYUSERNAME table field - Description of the Technical User Account
▼
Description: Description of the Technical User Account Field Name: RELEASEDBYUSERNAME Data Element: SUIDTECHDESC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RELEASEDBYUSERNAME
|
CCRRFAMTP-CMPLRQRSLTPROCESSINGSTATUS table field - Processing Status
▼
Description: Processing Status Field Name: CMPLRQRSLTPROCESSINGSTATUS Data Element: CMPLRQRSLTPROCESSINGSTATUS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQRSLTPROCESSINGSTATUS
|
CCRRFAMTP-CMPLRQVERSNAME table field - Compliance Requirement Name
▼
Description: Compliance Requirement Name Field Name: CMPLRQVERSNAME Data Element: EHFND_CRR_CRV_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQVERSNAME
|
CCRRFAMTP-CHMLCMPLNCINTERNALNAME table field - Internal Name
▼
Description: Internal Name Field Name: CHMLCMPLNCINTERNALNAME Data Element: EHFND_CCI_INTERNAL_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINTERNALNAME
|
CCRRFAMTP-CHMLCMPLNCAPPLICATION table field - Applications
▼
Description: Applications Field Name: CHMLCMPLNCAPPLICATION Data Element: EHPMA_APPLICATION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCAPPLICATION
|
CCRRFAMTP-MATERIAL table field - Product
▼
Description: Product Field Name: MATERIAL Data Element: EHFND_CCI_PRODUCT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIAL
|
CCRRFAMTP-CHMLCMPLNCINFOCOMBINEDNAME table field - Unpackaged Product
▼
Description: Unpackaged Product Field Name: CHMLCMPLNCINFOCOMBINEDNAME Data Element: EHFND_CCI_UP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFOCOMBINEDNAME
|
CCRRFAMTP-PCPRPTYOBJECTTITLE table field -
▼
Description: Field Name: PCPRPTYOBJECTTITLE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PCPRPTYOBJECTTITLE
|
CCRRFAMTP-PCPRPTYOBJECTDESC table field -
▼
Description: Field Name: PCPRPTYOBJECTDESC Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PCPRPTYOBJECTDESC
|
CCRRFAMTP-CHMLCMPLNCINFOTYPE table field - CCI Type
▼
Description: CCI Type Field Name: CHMLCMPLNCINFOTYPE Data Element: EHFND_CCI_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFOTYPE
|
CCRRFAMTP-CHMLCMPLNCPRODISRESEARCHED table field - Research and Development Sample
▼
Description: Research and Development Sample Field Name: CHMLCMPLNCPRODISRESEARCHED Data Element: EHFND_CCI_IS_RESEARCHED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCPRODISRESEARCHED
|
CCRRFAMTP-MATERIALISSOLD table field - Product is Sold
▼
Description: Product is Sold Field Name: MATERIALISSOLD Data Element: EHFND_CCI_IS_SOLD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISSOLD
|
CCRRFAMTP-MATERIALISTRANSPORTED table field - Product is Transported
▼
Description: Product is Transported Field Name: MATERIALISTRANSPORTED Data Element: EHFND_CCI_IS_TRANSPORTED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISTRANSPORTED
|
CCRRFAMTP-MATERIALISSOURCED table field - Product is Sourced
▼
Description: Product is Sourced Field Name: MATERIALISSOURCED Data Element: EHFND_CCI_IS_SOURCED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISSOURCED
|
CCRRFAMTP-MATERIALISPRODUCED table field - Product is Produced
▼
Description: Product is Produced Field Name: MATERIALISPRODUCED Data Element: EHFND_CCI_IS_PRODUCED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISPRODUCED
|
CCRRFAMTP-CHMLCMPLNCINFONAVGNLINK table field - Chemical Compliance Information
▼
Description: Chemical Compliance Information Field Name: CHMLCMPLNCINFONAVGNLINK Data Element: EHFND_CCI_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFONAVGNLINK
|
CCRRFAMTP-CHMLCMPLNCNAVGNLINKTORELDVERS table field - Compliance Assessment UUID
▼
Description: Compliance Assessment UUID Field Name: CHMLCMPLNCNAVGNLINKTORELDVERS Data Element: EHFND_CRR_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCNAVGNLINKTORELDVERS
|
CCRRFAMTP-VALIDITYSTARTDATETIME table field - Valid-From Date Time Stamp
▼
Description: Valid-From Date Time Stamp Field Name: VALIDITYSTARTDATETIME Data Element: EHFND_VALID_FROM_TSTMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALIDITYSTARTDATETIME
|
CCRRFAMTP-VALIDITYENDDATETIME table field - Valid-To Date Time Stamp
▼
Description: Valid-To Date Time Stamp Field Name: VALIDITYENDDATETIME Data Element: EHFND_VALID_TO_TSTMP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALIDITYENDDATETIME
|