Details |
CCNTRLPCITMCND-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CCNTRLPCITMCND-CENTRALPURCHASECONTRACT table field - Purchasing Document Number
▼
Description: Purchasing Document Number Field Name: CENTRALPURCHASECONTRACT Data Element: EBELN Data Type: length (Dec): 0(0) Check table: EKKO Conversion Routine: Domain Name: MemoryID: BES AppClass: SHLP: MEKK_C SHLP Field: EBELN ConvExit: See all SAP tables containing field CENTRALPURCHASECONTRACT
|
CCNTRLPCITMCND-CENTRALPURCHASECONTRACTITEM table field - Item Number of Purchasing Document
▼
Description: Item Number of Purchasing Document Field Name: CENTRALPURCHASECONTRACTITEM Data Element: EBELP Data Type: length (Dec): 0(0) Check table: EKPO Conversion Routine: Domain Name: MemoryID: BSP AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CENTRALPURCHASECONTRACTITEM
|
CCNTRLPCITMCND-CONDITIONVALIDITYENDDATE table field -
▼
Description: Field Name: CONDITIONVALIDITYENDDATE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONVALIDITYENDDATE
|
CCNTRLPCITMCND-CONDITIONTYPE table field - Condition Type
▼
Description: Condition Type Field Name: CONDITIONTYPE Data Element: KSCHA Data Type: length (Dec): 0(0) Check table: T685 Conversion Routine: Domain Name: MemoryID: VKS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONTYPE
|
CCNTRLPCITMCND-CONDITIONRECORD table field - Number of Condition Record
▼
Description: Number of Condition Record Field Name: CONDITIONRECORD Data Element: KNUMH Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONRECORD
|
CCNTRLPCITMCND-CONDITIONSEQUENTIALNUMBER table field - Sequential number of the condition
▼
Description: Sequential number of the condition Field Name: CONDITIONSEQUENTIALNUMBER Data Element: KOPOS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONSEQUENTIALNUMBER
|
CCNTRLPCITMCND-CONDITIONRECORDFOREDIT table field - Number of Condition Record
▼
Description: Number of Condition Record Field Name: CONDITIONRECORDFOREDIT Data Element: KNUMH Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONRECORDFOREDIT
|
CCNTRLPCITMCND-CNDNSEQUENTIALNUMBERFOREDIT table field - Sequential number of the condition
▼
Description: Sequential number of the condition Field Name: CNDNSEQUENTIALNUMBERFOREDIT Data Element: KOPOS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNDNSEQUENTIALNUMBERFOREDIT
|
CCNTRLPCITMCND-CNDNVALDTYENDDTEFOREDIT table field -
▼
Description: Field Name: CNDNVALDTYENDDTEFOREDIT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNDNVALDTYENDDTEFOREDIT
|
CCNTRLPCITMCND-CONDITIONTYPEFOREDIT table field - Condition Type
▼
Description: Condition Type Field Name: CONDITIONTYPEFOREDIT Data Element: KSCHA Data Type: length (Dec): 0(0) Check table: T685 Conversion Routine: Domain Name: MemoryID: VKS AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONTYPEFOREDIT
|
CCNTRLPCITMCND-CONDITIONVALIDITYSTARTDATE table field -
▼
Description: Field Name: CONDITIONVALIDITYSTARTDATE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONVALIDITYSTARTDATE
|
CCNTRLPCITMCND-CONDITIONRATEVALUE table field - Condition amount or percentage where no scale exists
▼
Description: Condition amount or percentage where no scale exists Field Name: CONDITIONRATEVALUE Data Element: KBETR_KOND Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONRATEVALUE
|
CCNTRLPCITMCND-CONDITIONRATEVALUEUNIT table field - Condition Unit (Currency or Percentage)
▼
Description: Condition Unit (Currency or Percentage) Field Name: CONDITIONRATEVALUEUNIT Data Element: KONWA Data Type: length (Dec): 0(0) Check table: TCURC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONRATEVALUEUNIT
|
CCNTRLPCITMCND-CONDITIONQUANTITY table field - Condition Pricing Unit
▼
Description: Condition Pricing Unit Field Name: CONDITIONQUANTITY Data Element: KPEIN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONQUANTITY
|
CCNTRLPCITMCND-CONDITIONQUANTITYUNIT table field - Condition Unit
▼
Description: Condition Unit Field Name: CONDITIONQUANTITYUNIT Data Element: KMEIN Data Type: length (Dec): 0(0) Check table: T006 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONQUANTITYUNIT
|
CCNTRLPCITMCND-CONDITIONAPPLICATION table field - Application
▼
Description: Application Field Name: CONDITIONAPPLICATION Data Element: KAPPL Data Type: length (Dec): 0(0) Check table: T681A Conversion Routine: Domain Name: MemoryID: KAP AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONAPPLICATION
|
CCNTRLPCITMCND-CONDITIONCALCULATIONTYPE table field - Calculation Type for Condition
▼
Description: Calculation Type for Condition Field Name: CONDITIONCALCULATIONTYPE Data Element: KRECH Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KRECH MemoryID: AppClass: VF SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONCALCULATIONTYPE
|
CCNTRLPCITMCND-CONDITIONISDELETED table field - Deletion Indicator for Condition Record
▼
Description: Deletion Indicator for Condition Record Field Name: CONDITIONISDELETED Data Element: LOEVM_KO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONISDELETED
|
CCNTRLPCITMCND-CONDITIONCLASSIFICATIONDESC table field -
▼
Description: Field Name: CONDITIONCLASSIFICATIONDESC Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONCLASSIFICATIONDESC
|
CCNTRLPCITMCND-CONDITIONCLASSIFICATION table field -
▼
Description: Field Name: CONDITIONCLASSIFICATION Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONDITIONCLASSIFICATION
|