Details |
CCMMFILLSTG-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CCMMFILLSTG-CMMDTYFILLSTAGUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: CMMDTYFILLSTAGUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFILLSTAGUUID
|
CCMMFILLSTG-COMMODITYORDERREQUEST table field - Commodity Order Request ID
▼
Description: Commodity Order Request ID Field Name: COMMODITYORDERREQUEST Data Element: CMMFDOF_CMMDTYORDERREQUESTID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERREQUEST
|
CCMMFILLSTG-CMMDTYORDERREQUESTFLOWTYPE table field - Commodity Derivative Order Request Flow Type
▼
Description: Commodity Derivative Order Request Flow Type Field Name: CMMDTYORDERREQUESTFLOWTYPE Data Element: CMMFDOR_ORDERREQUESTFLOWTYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTFLOWTYPE
|
CCMMFILLSTG-CMMDTYDERIVATIVEFLOWTYPETEXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CMMDTYDERIVATIVEFLOWTYPETEXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDERIVATIVEFLOWTYPETEXT
|
CCMMFILLSTG-MARKETIDENTIFIERCODE table field - Market Identifier Code
▼
Description: Market Identifier Code Field Name: MARKETIDENTIFIERCODE Data Element: TBA_MIC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: TBA_MIC AppClass: SHLP: TBAH_MIC SHLP Field: MIC ConvExit: See all SAP tables containing field MARKETIDENTIFIERCODE
|
CCMMFILLSTG-CMMDTYORDERFILLREQUESTTYPE table field - Commodity Derivative Fill Packet Type
▼
Description: Commodity Derivative Fill Packet Type Field Name: CMMDTYORDERFILLREQUESTTYPE Data Element: CMMFDOF_FILLTYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: CMMFDOF_H_FILLTYPE SHLP Field: COMMODITYDERIVATIVEFILLTYPE ConvExit: See all SAP tables containing field CMMDTYORDERFILLREQUESTTYPE
|
CCMMFILLSTG-CMMDTYORDERFILLREQUESTTYPEDESC table field - Fill Packet Type Description
▼
Description: Fill Packet Type Description Field Name: CMMDTYORDERFILLREQUESTTYPEDESC Data Element: CMMFDOF_FILLTYPEDESCRIPTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERFILLREQUESTTYPEDESC
|
CCMMFILLSTG-CMMDTYORDERFILLCOUNTERPARTY table field - Commodity Order Fill Counter Party
▼
Description: Commodity Order Fill Counter Party Field Name: CMMDTYORDERFILLCOUNTERPARTY Data Element: CMMFDOF_CMMDTYFILLCOUNTERPARTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERFILLCOUNTERPARTY
|
CCMMFILLSTG-CMMDTYORDREQCNTRPTYBROKER table field - Counterparty Broker
▼
Description: Counterparty Broker Field Name: CMMDTYORDREQCNTRPTYBROKER Data Element: CMMFDOR_CNTRPARTY_BROKER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQCNTRPTYBROKER
|
CCMMFILLSTG-REFERENCEBROKERACCOUNT table field - Counterparty Reference Account
▼
Description: Counterparty Reference Account Field Name: REFERENCEBROKERACCOUNT Data Element: CMMFDOF_REFERENCEBROKERACCOUNT Data Type: CHAR length (Dec): 80(0) Check table: Conversion Routine: ALPHA Domain Name: CMMFSA_REFERENCEBROKERACCOUNT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field REFERENCEBROKERACCOUNT
|
CCMMFILLSTG-COMMODITYSUBACCOUNT table field - Commodity Subaccount ID
▼
Description: Commodity Subaccount ID Field Name: COMMODITYSUBACCOUNT Data Element: CMMFSA_SUBACCOUNTID Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: CMMFSA_SUBACCOUNTID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field COMMODITYSUBACCOUNT
|
CCMMFILLSTG-CMMDTYORDREQCNTRPTYSUBACCT table field - Commodity Order Request Counterparty Subaccount
▼
Description: Commodity Order Request Counterparty Subaccount Field Name: CMMDTYORDREQCNTRPTYSUBACCT Data Element: CMMFDOR_ORDREQCNTRPTYSUBACCT Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: CMMFSA_SUBACCOUNTID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field CMMDTYORDREQCNTRPTYSUBACCT
|
CCMMFILLSTG-CMMDTYORDERREQLEGOWNERROLE table field - Commodity Derivative Order Leg Owner
▼
Description: Commodity Derivative Order Leg Owner Field Name: CMMDTYORDERREQLEGOWNERROLE Data Element: CMMFDOR_CMMDTYORDERREQLEGOWNER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQLEGOWNERROLE
|
CCMMFILLSTG-CMMDTYORDERFILLQUANTITYINLOTS table field - Commodity Order Fill Quantity In Lots
▼
Description: Commodity Order Fill Quantity In Lots Field Name: CMMDTYORDERFILLQUANTITYINLOTS Data Element: CMMFDOF_CMMDTYFILLQTYINLOTS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERFILLQUANTITYINLOTS
|
CCMMFILLSTG-CMMDTYMATURITYMONTHYEAR table field - Maturity Key Date (YYYYMMDD) Or Year/Month(YYYYMM)
▼
Description: Maturity Key Date (YYYYMMDD) Or Year/Month(YYYYMM) Field Name: CMMDTYMATURITYMONTHYEAR Data Element: CMMFDOF_AIF_MATURITY_MON_YR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYMATURITYMONTHYEAR
|
CCMMFILLSTG-COMMODITYPRODUCTSYMBOL table field - Product Symbol
▼
Description: Product Symbol Field Name: COMMODITYPRODUCTSYMBOL Data Element: CMMFDOF_PRODUCT_SYMBOL Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYPRODUCTSYMBOL
|
CCMMFILLSTG-CMMDTYORDERFILLDATETIME table field - Transaction Time
▼
Description: Transaction Time Field Name: CMMDTYORDERFILLDATETIME Data Element: CMMFDOF_CMMDTYORDFILLDATETIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERFILLDATETIME
|
CCMMFILLSTG-CMMDTYORDREQUESTQUANTITYINLOT table field - Order Quantity In Lots
▼
Description: Order Quantity In Lots Field Name: CMMDTYORDREQUESTQUANTITYINLOT Data Element: CMMFDOF_CMMDTYFLPKTFLEDQTYLOTS Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CMMFDOF_CMMDTYFLPKTFLEDQTYLOTS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQUESTQUANTITYINLOT
|
CCMMFILLSTG-CMMDTYORDREQRMNGQTYINLOTS table field - Remaining Quantity In Lots
▼
Description: Remaining Quantity In Lots Field Name: CMMDTYORDREQRMNGQTYINLOTS Data Element: CMMFDOF_CMMDTYFLPKTRMGQTYLOTS Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CMMFDOF_CMMDTYFLPKTRMGQTYLOTS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQRMNGQTYINLOTS
|
CCMMFILLSTG-CMMDTYFILLPACKETMSGORDID table field - Commodity Order Fill External Source Reference
▼
Description: Commodity Order Fill External Source Reference Field Name: CMMDTYFILLPACKETMSGORDID Data Element: CMMFDOF_CMMDTYORDFILLEXTORDREF Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFILLPACKETMSGORDID
|
CCMMFILLSTG-CMMDTYFILLPACKETTRDEXECUTIONID table field - Commodity Order Fill Trade Execution ID
▼
Description: Commodity Order Fill Trade Execution ID Field Name: CMMDTYFILLPACKETTRDEXECUTIONID Data Element: CMMFDOF_CMMDTYORDFILLTRDEXECID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFILLPACKETTRDEXECUTIONID
|
CCMMFILLSTG-CMMDTYORDERFILLPRICE table field - Fill Price of Commodity Derivative Order
▼
Description: Fill Price of Commodity Derivative Order Field Name: CMMDTYORDERFILLPRICE Data Element: CMMFDOF_CMMDTYORDERFILLPRICECH Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERFILLPRICE
|
CCMMFILLSTG-COMMODITYORDERREQUESTTICKS table field - Commodity Order Request Ticks
▼
Description: Commodity Order Request Ticks Field Name: COMMODITYORDERREQUESTTICKS Data Element: CMMFDOR_ORDREQTICKS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERREQUESTTICKS
|
CCMMFILLSTG-CMMDTYORDFILLMULTILEGTYPE table field - Multileg Type
▼
Description: Multileg Type Field Name: CMMDTYORDFILLMULTILEGTYPE Data Element: CMMFDOF_MULTILEGTYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDFILLMULTILEGTYPE
|
CCMMFILLSTG-CMMDTYORDFILLMULTILEGTYPETEXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CMMDTYORDFILLMULTILEGTYPETEXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDFILLMULTILEGTYPETEXT
|
CCMMFILLSTG-COMMODITYORDERREQUESTTRADER table field - Trader
▼
Description: Trader Field Name: COMMODITYORDERREQUESTTRADER Data Element: RDEALER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERREQUESTTRADER
|
CCMMFILLSTG-COMMODITYORDERREQUESTUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: COMMODITYORDERREQUESTUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERREQUESTUUID
|
CCMMFILLSTG-CMMDTYORDERREQREJECTIONREASON table field - Commodity Derivative Order Request Rejection Reason
▼
Description: Commodity Derivative Order Request Rejection Reason Field Name: CMMDTYORDERREQREJECTIONREASON Data Element: CMMFDOR_ORDERREQREJREASON Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQREJECTIONREASON
|
CCMMFILLSTG-COMMODITYORDERREQUESTCOMMENT table field - Commodity Derivative Order Request Comment
▼
Description: Commodity Derivative Order Request Comment Field Name: COMMODITYORDERREQUESTCOMMENT Data Element: CMMFDOR_ORDERREQUESTCOMMENT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERREQUESTCOMMENT
|
CCMMFILLSTG-CMMDTYFIXTYPE table field - Fix Type
▼
Description: Fix Type Field Name: CMMDTYFIXTYPE Data Element: CMMFDAI_FIXTYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFIXTYPE
|
CCMMFILLSTG-CMMDTYFIXTYPETEXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CMMDTYFIXTYPETEXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFIXTYPETEXT
|
CCMMFILLSTG-CMMDTYFIXACTION table field - Inbound FIX Action
▼
Description: Inbound FIX Action Field Name: CMMDTYFIXACTION Data Element: CMMFDAI_FIXACTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFIXACTION
|
CCMMFILLSTG-CMMDTYFIXACTIONTEXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CMMDTYFIXACTIONTEXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFIXACTIONTEXT
|
CCMMFILLSTG-CMMDTYORDREQPRCGEXECINSTRNCAT table field - Pricing and Execution Instruction Category
▼
Description: Pricing and Execution Instruction Category Field Name: CMMDTYORDREQPRCGEXECINSTRNCAT Data Element: CMMFDOR_ORDPRCGEXECINSTRNCAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQPRCGEXECINSTRNCAT
|
CCMMFILLSTG-CMMDTYORDREQPRCEXECINSTEXT table field - Cmmdty Drvtv Order Pricing Execution Instruction Description
▼
Description: Cmmdty Drvtv Order Pricing Execution Instruction Description Field Name: CMMDTYORDREQPRCEXECINSTEXT Data Element: CMMFDOR_ORDERPRCGEXECINSTTXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQPRCEXECINSTEXT
|
CCMMFILLSTG-COMMODITYORDERFILLPACKETUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: COMMODITYORDERFILLPACKETUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERFILLPACKETUUID
|
CCMMFILLSTG-CMMDTYORDERISFILLWITHORDER table field - Commodity Derivative Fill Uploaded With Order
▼
Description: Commodity Derivative Fill Uploaded With Order Field Name: CMMDTYORDERISFILLWITHORDER Data Element: CMMFDOF_ISFILLWITHORDER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERISFILLWITHORDER
|
CCMMFILLSTG-CMMDTYORDERREQUESTTYPE table field - Commodity Derivative Order Request Type
▼
Description: Commodity Derivative Order Request Type Field Name: CMMDTYORDERREQUESTTYPE Data Element: CMMFDOR_ORDERTYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: CMMODY AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTTYPE
|
CCMMFILLSTG-CMMDTYFIXMSGSTAGINGSTATUS table field - Fix Message staging status
▼
Description: Fix Message staging status Field Name: CMMDTYFIXMSGSTAGINGSTATUS Data Element: CMMFDAI_FIXMSG_STAGING_STATUS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFIXMSGSTAGINGSTATUS
|
CCMMFILLSTG-CMMDTYFIXMSGPROCESSINGGROUP table field - Fix message processing group
▼
Description: Fix message processing group Field Name: CMMDTYFIXMSGPROCESSINGGROUP Data Element: CMMFDAI_FIXMSG_PROCESSING_GRP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFIXMSGPROCESSINGGROUP
|
CCMMFILLSTG-CMMDTYFIXMSGSTAGINGSTATUSTEXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CMMDTYFIXMSGSTAGINGSTATUSTEXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFIXMSGSTAGINGSTATUSTEXT
|
CCMMFILLSTG-CMMDTYFIXMSGSTAGEDDATE table field - Fix message received on Date
▼
Description: Fix message received on Date Field Name: CMMDTYFIXMSGSTAGEDDATE Data Element: CMMFDAI_FIXMSGRECEIVEDONDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFIXMSGSTAGEDDATE
|
CCMMFILLSTG-CMMDTYFIXMSGSTAGEDTIME table field - Fix message received on Time
▼
Description: Fix message received on Time Field Name: CMMDTYFIXMSGSTAGEDTIME Data Element: CMMFDAI_FIXMSGRECEIVEDONTIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFIXMSGSTAGEDTIME
|
CCMMFILLSTG-CMMDTYFIXSTAGEDLASTPROCDATE table field - Fix message Last processing Date
▼
Description: Fix message Last processing Date Field Name: CMMDTYFIXSTAGEDLASTPROCDATE Data Element: CMMFDAI_FIXMSGPROCESSINGONDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFIXSTAGEDLASTPROCDATE
|
CCMMFILLSTG-CMMDTYFIXSTAGEDLASTPROCTIME table field - Fix message Last processing Time
▼
Description: Fix message Last processing Time Field Name: CMMDTYFIXSTAGEDLASTPROCTIME Data Element: CMMFDAI_FIXMSGPROCESSINGONTIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFIXSTAGEDLASTPROCTIME
|