Details |
CCMMDTYORDREQTP-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: T000 Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CCMMDTYORDREQTP-COMMODITYORDERREQUESTUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: COMMODITYORDERREQUESTUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERREQUESTUUID
|
CCMMDTYORDREQTP-COMMODITYORDERREQUEST table field - Commodity Derivative Order Request ID
▼
Description: Commodity Derivative Order Request ID Field Name: COMMODITYORDERREQUEST Data Element: CMMFDOR_ORDERREQUESTID Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: CMMFDOR_ORDERREQUESTID MemoryID: CMMORD AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field COMMODITYORDERREQUEST
|
CCMMDTYORDREQTP-CMMDTYORDREQSENTTOBRKRDATETIME table field - Commodity Derivative Order Request Sent to Broker Time Stamp
▼
Description: Commodity Derivative Order Request Sent to Broker Time Stamp Field Name: CMMDTYORDREQSENTTOBRKRDATETIME Data Element: CMMFDOR_ORDREQSENTTOBRKRDTETME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSENTTOBRKRDATETIME
|
CCMMDTYORDREQTP-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: length (Dec): 0(0) Check table: T001 Conversion Routine: Domain Name: MemoryID: BUK AppClass: SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
CCMMDTYORDREQTP-COMPANYCODENAME table field - Name of Company Code or Company
▼
Description: Name of Company Code or Company Field Name: COMPANYCODENAME Data Element: BUTXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPANYCODENAME
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTTYPETEXT table field - Commodity Derivative Order Type Description
▼
Description: Commodity Derivative Order Type Description Field Name: CMMDTYORDERREQUESTTYPETEXT Data Element: CMMFDOR_ORDERTYPEDESCRIPTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTTYPETEXT
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTTYPE table field - Commodity Derivative Order Request Type
▼
Description: Commodity Derivative Order Request Type Field Name: CMMDTYORDERREQUESTTYPE Data Element: CMMFDOR_ORDERTYPE Data Type: length (Dec): 0(0) Check table: CMMFDOR_C_ORDTYP Conversion Routine: Domain Name: MemoryID: CMMODY AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTTYPE
|
CCMMDTYORDREQTP-COMMODITYORDERFILLCATEGORY table field - Commodity Derivative Order Category
▼
Description: Commodity Derivative Order Category Field Name: COMMODITYORDERFILLCATEGORY Data Element: CMMFDOR_ORDERCATEGORY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERFILLCATEGORY
|
CCMMDTYORDREQTP-CMMDTYORDERREQDOCCARDINALVALUE table field - Commodity Derivative Order Request Document Cardinal Value
▼
Description: Commodity Derivative Order Request Document Cardinal Value Field Name: CMMDTYORDERREQDOCCARDINALVALUE Data Element: CMMFDOR_ORDREQDOCCARDINALVALUE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQDOCCARDINALVALUE
|
CCMMDTYORDREQTP-COMMODITYORDREQSTATUSREASON table field - Order Request Status Reason
▼
Description: Order Request Status Reason Field Name: COMMODITYORDREQSTATUSREASON Data Element: CMMFDOR_ORDERREQUSTATUSREASON Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDREQSTATUSREASON
|
CCMMDTYORDREQTP-CMMDTYORDERREQREJECTIONREASON table field - Commodity Derivative Order Request Rejection Reason
▼
Description: Commodity Derivative Order Request Rejection Reason Field Name: CMMDTYORDERREQREJECTIONREASON Data Element: CMMFDOR_ORDERREQREJREASON Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQREJECTIONREASON
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTKIND table field - Commodity Derivative Order Kind
▼
Description: Commodity Derivative Order Kind Field Name: CMMDTYORDERREQUESTKIND Data Element: CMMFDOR_ORDERKIND Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTKIND
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTKINDTEXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CMMDTYORDERREQUESTKINDTEXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTKINDTEXT
|
CCMMDTYORDREQTP-CMMDTYORDFILLCOUNTERPARTYINFO table field - Commodity Derivative Counterparty Information
▼
Description: Commodity Derivative Counterparty Information Field Name: CMMDTYORDFILLCOUNTERPARTYINFO Data Element: CMMFDOR_COUNTERPARTYINFO Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDFILLCOUNTERPARTYINFO
|
CCMMDTYORDREQTP-CMMDTYDRVTVCOUNTERPARTYINFOTXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CMMDTYDRVTVCOUNTERPARTYINFOTXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVCOUNTERPARTYINFOTXT
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTREASON table field - Commodity Derivative Order Request Reason
▼
Description: Commodity Derivative Order Request Reason Field Name: CMMDTYORDERREQUESTREASON Data Element: CMMFDOR_ORDERREQUESTRSN Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: CMMODR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTREASON
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTFLOWTYPE table field - Commodity Order Request Flow Type Text
▼
Description: Commodity Order Request Flow Type Text Field Name: CMMDTYORDERREQUESTFLOWTYPE Data Element: CMMFDOR_ORDERREQFLOWTYPETEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTFLOWTYPE
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTREASONTEXT table field - Description of Order Request Reason
▼
Description: Description of Order Request Reason Field Name: CMMDTYORDERREQUESTREASONTEXT Data Element: CMMFDOR_ORDREQREASONTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTREASONTEXT
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTSTATUS table field - Commodity Derivative Order Request Status
▼
Description: Commodity Derivative Order Request Status Field Name: CMMDTYORDERREQUESTSTATUS Data Element: CMMFDOR_ORDERREQUESTSTATUS Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: CMMFDOR_ORDERREQUESTSTATUS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTSTATUS
|
CCMMDTYORDREQTP-STATUSCRITICALITY table field -
▼
Description: Field Name: STATUSCRITICALITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STATUSCRITICALITY
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTSTATUSTEXT table field - Commodity Derivative Order Request Status Text
▼
Description: Commodity Derivative Order Request Status Text Field Name: CMMDTYORDERREQUESTSTATUSTEXT Data Element: CMMFDOR_ORDREQSTATUSTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTSTATUSTEXT
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTSOURCE table field - Commodity Derivative Order Request Source
▼
Description: Commodity Derivative Order Request Source Field Name: CMMDTYORDERREQUESTSOURCE Data Element: CMMFDOR_CMMDTYORDREQUESTSOURCE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTSOURCE
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTSOURCETEXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CMMDTYORDERREQUESTSOURCETEXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTSOURCETEXT
|
CCMMDTYORDREQTP-CMMDTYORDREQPRICINGPROGRAM table field - Commodity Derivative Order Request Pricing Program
▼
Description: Commodity Derivative Order Request Pricing Program Field Name: CMMDTYORDREQPRICINGPROGRAM Data Element: CMMFDOR_ORDREQPRICINGPROGRAM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQPRICINGPROGRAM
|
CCMMDTYORDREQTP-COMMODITYORDERREQUESTTRADER table field - Trader
▼
Description: Trader Field Name: COMMODITYORDERREQUESTTRADER Data Element: RDEALER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERREQUESTTRADER
|
CCMMDTYORDREQTP-COMMODITYORDERREQUESTCOMMENT table field - Commodity Derivative Order Request Comment
▼
Description: Commodity Derivative Order Request Comment Field Name: COMMODITYORDERREQUESTCOMMENT Data Element: CMMFDOR_ORDERREQUESTCOMMENT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERREQUESTCOMMENT
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTEXCHANGETYPE table field - Commodity Derivative Order Request Exchange Type
▼
Description: Commodity Derivative Order Request Exchange Type Field Name: CMMDTYORDERREQUESTEXCHANGETYPE Data Element: CMMFDOR_ORDREQEXCHANGETYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTEXCHANGETYPE
|
CCMMDTYORDREQTP-CMMDTYORDREQEXCHANGETYPETEXT table field - Commodity Derivative Order Request Exchange Type Text
▼
Description: Commodity Derivative Order Request Exchange Type Text Field Name: CMMDTYORDREQEXCHANGETYPETEXT Data Element: CMMFDOR_ORDREQEXCHANGETYPETEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQEXCHANGETYPETEXT
|
CCMMDTYORDREQTP-CMMDTYORDREQNEGTTNDATETIME table field - Commodity Derivative Order Request Negotiation Date Time
▼
Description: Commodity Derivative Order Request Negotiation Date Time Field Name: CMMDTYORDREQNEGTTNDATETIME Data Element: CMMFDOR_ORDNEGOTIATIONDATETIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQNEGTTNDATETIME
|
CCMMDTYORDREQTP-CMMDTYORDERREQNEGOTIATIONDATE table field - Commodity Derivative Order Request Negotiation Date
▼
Description: Commodity Derivative Order Request Negotiation Date Field Name: CMMDTYORDERREQNEGOTIATIONDATE Data Element: CMMFDOR_ORDNEGOTIATEDON Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQNEGOTIATIONDATE
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTPROCESSSTEP table field - Commodity Derivative Order Request Process Step
▼
Description: Commodity Derivative Order Request Process Step Field Name: CMMDTYORDERREQUESTPROCESSSTEP Data Element: CMMFDOR_ORDREQPROCESSSTEP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTPROCESSSTEP
|
CCMMDTYORDREQTP-CMMDTYORDREQINITIALSTATUSISSET table field - Order Request Initial Status is Set
▼
Description: Order Request Initial Status is Set Field Name: CMMDTYORDREQINITIALSTATUSISSET Data Element: CMMFDOR_ORDREQINITIALSTATUS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQINITIALSTATUSISSET
|
CCMMDTYORDREQTP-CMMDTYORDREQEXPIRYINSTRUCTION table field - Commodity Derivative Order Request Expiry Instruction
▼
Description: Commodity Derivative Order Request Expiry Instruction Field Name: CMMDTYORDREQEXPIRYINSTRUCTION Data Element: CMMFDOR_ORDEREXPIRATIONINST Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQEXPIRYINSTRUCTION
|
CCMMDTYORDREQTP-CMMDTYORDREQCNTRPTYSUBACCTNAME table field - Commodity Subaccount Name
▼
Description: Commodity Subaccount Name Field Name: CMMDTYORDREQCNTRPTYSUBACCTNAME Data Element: CMMFSA_SUBACCOUNTNAME Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: CMMFSA_SUBACCOUNTNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQCNTRPTYSUBACCTNAME
|
CCMMDTYORDREQTP-CMMDTYORDREQCNTRPTYSUBACCT table field - Commodity Order Request Counterparty Subaccount
▼
Description: Commodity Order Request Counterparty Subaccount Field Name: CMMDTYORDREQCNTRPTYSUBACCT Data Element: CMMFDOR_ORDREQCNTRPTYSUBACCT Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: CMMFSA_SUBACCOUNTID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field CMMDTYORDREQCNTRPTYSUBACCT
|
CCMMDTYORDREQTP-CMMDTYORDREQCNTRPTYSUBACCTUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: CMMDTYORDREQCNTRPTYSUBACCTUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQCNTRPTYSUBACCTUUID
|
CCMMDTYORDREQTP-DERIVATIVECONTRSPECIFICATION table field - Derivative Contract Specification (DCS)
▼
Description: Derivative Contract Specification (DCS) Field Name: DERIVATIVECONTRSPECIFICATION Data Element: CMMFSA_DERIVATIVECONTRACTSPEC Data Type: length (Dec): 0(0) Check table: TBAC_DCS Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DERIVATIVECONTRSPECIFICATION
|
CCMMDTYORDREQTP-MARKETIDENTIFIERCODE table field - Market Identifier Code (MIC)
▼
Description: Market Identifier Code (MIC) Field Name: MARKETIDENTIFIERCODE Data Element: CMMFSA_MARKETIDENTIFERCODE Data Type: length (Dec): 0(0) Check table: TBAC_MIC Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MARKETIDENTIFIERCODE
|
CCMMDTYORDREQTP-COUNTERPARTY table field - Counterparty Number
▼
Description: Counterparty Number Field Name: COUNTERPARTY Data Element: RKONTRAH_NEW Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: BPA AppClass: SHLP: BUPA SHLP Field: PARTNER ConvExit: See all SAP tables containing field COUNTERPARTY
|
CCMMDTYORDREQTP-CMMDTYORDREQCNTRPTYBROKER table field - Counterparty Broker
▼
Description: Counterparty Broker Field Name: CMMDTYORDREQCNTRPTYBROKER Data Element: CMMFDOR_CNTRPARTY_BROKER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQCNTRPTYBROKER
|
CCMMDTYORDREQTP-CMMDTYORDCNTRPTYBROKERREFACCT table field - Cmmdty Order Request Counterparty Broker Reference Account
▼
Description: Cmmdty Order Request Counterparty Broker Reference Account Field Name: CMMDTYORDCNTRPTYBROKERREFACCT Data Element: CMMFDOR_CNTRPTYBROKERREFACCT Data Type: CHAR length (Dec): 80(0) Check table: CMMFSA_D_BRORACC Conversion Routine: ALPHA Domain Name: CMMFSA_REFERENCEBROKERACCOUNT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field CMMDTYORDCNTRPTYBROKERREFACCT
|
CCMMDTYORDREQTP-CMMDTYORDINTERNALCOUNTERPARTY table field - CDOTE Internal Counterparty
▼
Description: CDOTE Internal Counterparty Field Name: CMMDTYORDINTERNALCOUNTERPARTY Data Element: CMMFDOR_INT_COUNTERPARTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDINTERNALCOUNTERPARTY
|
CCMMDTYORDREQTP-CMMDTYORDERREQMSGISAVAILABLE table field - Commodity Order Request Message Availability
▼
Description: Commodity Order Request Message Availability Field Name: CMMDTYORDERREQMSGISAVAILABLE Data Element: CMMFDOR_ORDREQMSGAVAILABILITY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQMSGISAVAILABLE
|
CCMMDTYORDREQTP-HASERRORDESCRIPTION table field - Commodity Order Request Message Availability Text
▼
Description: Commodity Order Request Message Availability Text Field Name: HASERRORDESCRIPTION Data Element: CMMFDOR_ORDREQMSGAVAILTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field HASERRORDESCRIPTION
|
CCMMDTYORDREQTP-CMMDTYORDREQMESSAGEDATETIME table field - Timestamp of record creation
▼
Description: Timestamp of record creation Field Name: CMMDTYORDREQMESSAGEDATETIME Data Element: CMMFDOF_MSGCREATIONDATETIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQMESSAGEDATETIME
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTMESSAGEDATE table field - Date of record creation
▼
Description: Date of record creation Field Name: CMMDTYORDERREQUESTMESSAGEDATE Data Element: CMMFDOF_MSGCREATIONDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTMESSAGEDATE
|
CCMMDTYORDREQTP-NUMBEROFERRORMESSAGES table field -
▼
Description: Field Name: NUMBEROFERRORMESSAGES Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFERRORMESSAGES
|
CCMMDTYORDREQTP-NUMBEROFWARNINGMESSAGES table field -
▼
Description: Field Name: NUMBEROFWARNINGMESSAGES Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFWARNINGMESSAGES
|
CCMMDTYORDREQTP-CMMDTYORDREQNROFASSIGNEDDOCS table field -
▼
Description: Field Name: CMMDTYORDREQNROFASSIGNEDDOCS Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQNROFASSIGNEDDOCS
|
CCMMDTYORDREQTP-CMMDTYORDREQNROFASSIGNEDFILLS table field -
▼
Description: Field Name: CMMDTYORDREQNROFASSIGNEDFILLS Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQNROFASSIGNEDFILLS
|
CCMMDTYORDREQTP-CMMDTYORDREQNROFRELTDBRACKETS table field -
▼
Description: Field Name: CMMDTYORDREQNROFRELTDBRACKETS Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQNROFRELTDBRACKETS
|
CCMMDTYORDREQTP-NUMBEROFRECORDS table field -
▼
Description: Field Name: NUMBEROFRECORDS Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFRECORDS
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTLONGFLOWTYPE table field - Commodity Derivative Order Request Flow Type
▼
Description: Commodity Derivative Order Request Flow Type Field Name: CMMDTYORDERREQUESTLONGFLOWTYPE Data Element: CMMFDOR_ORDERREQUESTFLOWTYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTLONGFLOWTYPE
|
CCMMDTYORDREQTP-CMMDTYORDREQLONGFLOWTYPETEXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CMMDTYORDREQLONGFLOWTYPETEXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLONGFLOWTYPETEXT
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTLONGFUTURE table field - Commodity Order Request Future ID
▼
Description: Commodity Order Request Future ID Field Name: CMMDTYORDERREQUESTLONGFUTURE Data Element: CMMFDOR_CMMDTYORDFILLFUTURE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTLONGFUTURE
|
CCMMDTYORDREQTP-CMMDTYORDREQUESTLONGFUTURENAME table field - Short Name
▼
Description: Short Name Field Name: CMMDTYORDREQUESTLONGFUTURENAME Data Element: XALKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQUESTLONGFUTURENAME
|
CCMMDTYORDREQTP-CMMDTYORDREQLONGCOMMODITY table field - Commodity Derivative Order Request Exchange Commodity
▼
Description: Commodity Derivative Order Request Exchange Commodity Field Name: CMMDTYORDREQLONGCOMMODITY Data Element: CMMFDOR_EXCHANGECOMMODITY Data Type: length (Dec): 0(0) Check table: TBAC_PHYSCOMM Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLONGCOMMODITY
|
CCMMDTYORDREQTP-CMMDTYORDREQLONGCOMMODITYNAME table field - Commodity Description
▼
Description: Commodity Description Field Name: CMMDTYORDREQLONGCOMMODITYNAME Data Element: CMMFSA_COMMODITYDESCRIPTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLONGCOMMODITYNAME
|
CCMMDTYORDREQTP-CMMDTYORDREQLONGMKTIDCODE table field - Market Identifier Code
▼
Description: Market Identifier Code Field Name: CMMDTYORDREQLONGMKTIDCODE Data Element: TBA_MIC Data Type: length (Dec): 0(0) Check table: TBAC_MIC Conversion Routine: Domain Name: MemoryID: TBA_MIC AppClass: SHLP: TBAH_MIC SHLP Field: MIC ConvExit: See all SAP tables containing field CMMDTYORDREQLONGMKTIDCODE
|
CCMMDTYORDREQTP-CMMDTYORDREQLONGMKTIDCODENAME table field - Market Identifier Code Description
▼
Description: Market Identifier Code Description Field Name: CMMDTYORDREQLONGMKTIDCODENAME Data Element: CMMFSA_MICTXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLONGMKTIDCODENAME
|
CCMMDTYORDREQTP-CMMDTYORDREQLONGDRVTVCONTRSPEC table field - Derivative Contract Specification (DCS)
▼
Description: Derivative Contract Specification (DCS) Field Name: CMMDTYORDREQLONGDRVTVCONTRSPEC Data Element: CMMFDOR_DERIVATIVECONTRACTSPEC Data Type: length (Dec): 0(0) Check table: TBAC_DCS Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLONGDRVTVCONTRSPEC
|
CCMMDTYORDREQTP-CMMDTYORDREQLONGDRVTVCONTRNAME table field - Description of Derivative Contract Specification
▼
Description: Description of Derivative Contract Specification Field Name: CMMDTYORDREQLONGDRVTVCONTRNAME Data Element: TBA_DCSID_TXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLONGDRVTVCONTRNAME
|
CCMMDTYORDREQTP-CMMDTYORDREQLONGMATURITYKEYDTE table field - Maturity Key Date
▼
Description: Maturity Key Date Field Name: CMMDTYORDREQLONGMATURITYKEYDTE Data Element: TBA_KEYDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLONGMATURITYKEYDTE
|
CCMMDTYORDREQTP-CMMDTYDRVTVLONGLEGMATURITYCODE table field - Contract Maturity Code
▼
Description: Contract Maturity Code Field Name: CMMDTYDRVTVLONGLEGMATURITYCODE Data Element: CMMFDOR_CONTRACT_CODE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVLONGLEGMATURITYCODE
|
CCMMDTYORDREQTP-CMMDTYDRVTVLONGMATURITYCODE table field - Contract Maturity Code
▼
Description: Contract Maturity Code Field Name: CMMDTYDRVTVLONGMATURITYCODE Data Element: CMMFDOR_CONTRACT_CODE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVLONGMATURITYCODE
|
CCMMDTYORDREQTP-CMMDTYDRVTVLONGMKTPRCPERQTYTXT table field - Commodity Order Request Last Known Market Price per Qty Text
▼
Description: Commodity Order Request Last Known Market Price per Qty Text Field Name: CMMDTYDRVTVLONGMKTPRCPERQTYTXT Data Element: CMMFDOR_LASTMKTPRCPERQTYTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVLONGMKTPRCPERQTYTXT
|
CCMMDTYORDREQTP-CMMDTYDRVTVLONGMKTPRCUPDATEDON table field - Commodity Derivative Last Known Market Price Updated On
▼
Description: Commodity Derivative Last Known Market Price Updated On Field Name: CMMDTYDRVTVLONGMKTPRCUPDATEDON Data Element: CMMFDOR_LASTMKTPRCUPDATEDON Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVLONGMKTPRCUPDATEDON
|
CCMMDTYORDREQTP-CMMDTYDRVTVLONGMKTPRICESOURCE table field - Commodity Order Request Last Known Market Price Source
▼
Description: Commodity Order Request Last Known Market Price Source Field Name: CMMDTYDRVTVLONGMKTPRICESOURCE Data Element: CMMFDOR_LASTKNWNMKTPRICESOURCE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVLONGMKTPRICESOURCE
|
CCMMDTYORDREQTP-CMMDTYDRVTVLONGMKTPRCSRCETEXT table field - Commodity Order Request Last Known Market Price Source Text
▼
Description: Commodity Order Request Last Known Market Price Source Text Field Name: CMMDTYDRVTVLONGMKTPRCSRCETEXT Data Element: CMMFDOR_LASTKNWNMKTPRCSRCTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVLONGMKTPRCSRCETEXT
|
CCMMDTYORDREQTP-CMMDTYORDREQUESTSHORTFLOWTYPE table field - Commodity Derivative Order Request Flow Type
▼
Description: Commodity Derivative Order Request Flow Type Field Name: CMMDTYORDREQUESTSHORTFLOWTYPE Data Element: CMMFDOR_ORDERREQUESTFLOWTYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQUESTSHORTFLOWTYPE
|
CCMMDTYORDREQTP-CMMDTYORDREQSHORTFLOWTYPETEXT table field - Short Text for Fixed Values
▼
Description: Short Text for Fixed Values Field Name: CMMDTYORDREQSHORTFLOWTYPETEXT Data Element: VAL_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSHORTFLOWTYPETEXT
|
CCMMDTYORDREQTP-CMMDTYORDREQSHORTFUTURE table field - Commodity Order Request Future ID
▼
Description: Commodity Order Request Future ID Field Name: CMMDTYORDREQSHORTFUTURE Data Element: CMMFDOR_CMMDTYORDFILLFUTURE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSHORTFUTURE
|
CCMMDTYORDREQTP-CMMDTYORDREQSHORTFUTURENAME table field - Short Name
▼
Description: Short Name Field Name: CMMDTYORDREQSHORTFUTURENAME Data Element: XALKZ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSHORTFUTURENAME
|
CCMMDTYORDREQTP-CMMDTYORDREQSHORTCOMMODITY table field - Commodity Derivative Order Request Exchange Commodity
▼
Description: Commodity Derivative Order Request Exchange Commodity Field Name: CMMDTYORDREQSHORTCOMMODITY Data Element: CMMFDOR_EXCHANGECOMMODITY Data Type: length (Dec): 0(0) Check table: TBAC_PHYSCOMM Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSHORTCOMMODITY
|
CCMMDTYORDREQTP-CMMDTYORDREQSHORTCOMMODITYNAME table field - Commodity Description
▼
Description: Commodity Description Field Name: CMMDTYORDREQSHORTCOMMODITYNAME Data Element: CMMFSA_COMMODITYDESCRIPTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSHORTCOMMODITYNAME
|
CCMMDTYORDREQTP-CMMDTYORDREQSHRTMKTIDCODE table field - Market Identifier Code
▼
Description: Market Identifier Code Field Name: CMMDTYORDREQSHRTMKTIDCODE Data Element: TBA_MIC Data Type: length (Dec): 0(0) Check table: TBAC_MIC Conversion Routine: Domain Name: MemoryID: TBA_MIC AppClass: SHLP: TBAH_MIC SHLP Field: MIC ConvExit: See all SAP tables containing field CMMDTYORDREQSHRTMKTIDCODE
|
CCMMDTYORDREQTP-CMMDTYORDREQSHRTMKTIDCODENAME table field - Market Identifier Code Description
▼
Description: Market Identifier Code Description Field Name: CMMDTYORDREQSHRTMKTIDCODENAME Data Element: CMMFSA_MICTXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSHRTMKTIDCODENAME
|
CCMMDTYORDREQTP-CMMDTYORDREQSHRTDRVTVCONTRSPEC table field - Derivative Contract Specification (DCS)
▼
Description: Derivative Contract Specification (DCS) Field Name: CMMDTYORDREQSHRTDRVTVCONTRSPEC Data Element: CMMFDOR_DERIVATIVECONTRACTSPEC Data Type: length (Dec): 0(0) Check table: TBAC_DCS Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSHRTDRVTVCONTRSPEC
|
CCMMDTYORDREQTP-CMMDTYORDREQSHRTDRVTVCONTRNAME table field - Description of Derivative Contract Specification
▼
Description: Description of Derivative Contract Specification Field Name: CMMDTYORDREQSHRTDRVTVCONTRNAME Data Element: TBA_DCSID_TXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSHRTDRVTVCONTRNAME
|
CCMMDTYORDREQTP-CMMDTYORDREQSHRTMATURITYKEYDTE table field - Maturity Key Date
▼
Description: Maturity Key Date Field Name: CMMDTYORDREQSHRTMATURITYKEYDTE Data Element: TBA_KEYDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSHRTMATURITYKEYDTE
|
CCMMDTYORDREQTP-CMMDTYDRVTVSHRTLEGMATURITYCODE table field - Contract Maturity Code
▼
Description: Contract Maturity Code Field Name: CMMDTYDRVTVSHRTLEGMATURITYCODE Data Element: CMMFDOR_CONTRACT_CODE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVSHRTLEGMATURITYCODE
|
CCMMDTYORDREQTP-CMMDTYDRVTVSHRTMATURITYCODE table field - Contract Maturity Code
▼
Description: Contract Maturity Code Field Name: CMMDTYDRVTVSHRTMATURITYCODE Data Element: CMMFDOR_CONTRACT_CODE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVSHRTMATURITYCODE
|
CCMMDTYORDREQTP-CMMDTYDRVTVSHRTMKTPRCPERQTYTXT table field - Commodity Order Request Last Known Market Price per Qty Text
▼
Description: Commodity Order Request Last Known Market Price per Qty Text Field Name: CMMDTYDRVTVSHRTMKTPRCPERQTYTXT Data Element: CMMFDOR_LASTMKTPRCPERQTYTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVSHRTMKTPRCPERQTYTXT
|
CCMMDTYORDREQTP-CMMDTYDRVTVSHRTMKTPRCUPDATEDON table field - Commodity Derivative Last Known Market Price Updated On
▼
Description: Commodity Derivative Last Known Market Price Updated On Field Name: CMMDTYDRVTVSHRTMKTPRCUPDATEDON Data Element: CMMFDOR_LASTMKTPRCUPDATEDON Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVSHRTMKTPRCUPDATEDON
|
CCMMDTYORDREQTP-CMMDTYDRVTVSHRTMKTPRICESOURCE table field - Commodity Order Request Last Known Market Price Source
▼
Description: Commodity Order Request Last Known Market Price Source Field Name: CMMDTYDRVTVSHRTMKTPRICESOURCE Data Element: CMMFDOR_LASTKNWNMKTPRICESOURCE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVSHRTMKTPRICESOURCE
|
CCMMDTYORDREQTP-CMMDTYDRVTVSHRTMKTPRCSRCETEXT table field - Commodity Order Request Last Known Market Price Source Text
▼
Description: Commodity Order Request Last Known Market Price Source Text Field Name: CMMDTYDRVTVSHRTMKTPRCSRCETEXT Data Element: CMMFDOR_LASTKNWNMKTPRCSRCTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVSHRTMKTPRCSRCETEXT
|
CCMMDTYORDREQTP-CMMDTYORDREQUESTQUANTITYINLOT table field - Commodity Derivative Order Request Quantity in Lots
▼
Description: Commodity Derivative Order Request Quantity in Lots Field Name: CMMDTYORDREQUESTQUANTITYINLOT Data Element: CMMFDOR_ORDREQNUMBEROFLOTS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQUESTQUANTITYINLOT
|
CCMMDTYORDREQTP-CMMDTYDERIVATIVEQUANTITYPERLOT table field - Derivative Contract Specification Quantity
▼
Description: Derivative Contract Specification Quantity Field Name: CMMDTYDERIVATIVEQUANTITYPERLOT Data Element: TBA_DCS_QNT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDERIVATIVEQUANTITYPERLOT
|
CCMMDTYORDREQTP-CMMDTYDRVTVQUANTITYUNITPERLOT table field - Derivative Contract Specification Unit of Measure
▼
Description: Derivative Contract Specification Unit of Measure Field Name: CMMDTYDRVTVQUANTITYUNITPERLOT Data Element: CMMFDOR_ORDREQDCSUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVQUANTITYUNITPERLOT
|
CCMMDTYORDREQTP-CMMDTYDERIVATIVECURRENCYPERLOT table field - Quotation Currency
▼
Description: Quotation Currency Field Name: CMMDTYDERIVATIVECURRENCYPERLOT Data Element: TBA_CURRENCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDERIVATIVECURRENCYPERLOT
|
CCMMDTYORDREQTP-CMMDTYORDREQTOBEFILLEDQTY table field - Remaining quantity of order to be filled
▼
Description: Remaining quantity of order to be filled Field Name: CMMDTYORDREQTOBEFILLEDQTY Data Element: CMMFDOR_CMMDTYORDREQFILLTOQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOBEFILLEDQTY
|
CCMMDTYORDREQTP-CMMDTYORDREQTOBEFILLEDQTYUNIT table field - Commodity Derivative Order Request Filled Quantity UOM
▼
Description: Commodity Derivative Order Request Filled Quantity UOM Field Name: CMMDTYORDREQTOBEFILLEDQTYUNIT Data Element: CMMFDOR_ORDREQTOBEFILLEDQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOBEFILLEDQTYUNIT
|
CCMMDTYORDREQTP-CMMDTYORDREQTOBEFILLEDQTYTXT table field -
▼
Description: Field Name: CMMDTYORDREQTOBEFILLEDQTYTXT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOBEFILLEDQTYTXT
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTQUANTITY table field - Commodity Derivative Order Request Quantity For Filling
▼
Description: Commodity Derivative Order Request Quantity For Filling Field Name: CMMDTYORDERREQUESTQUANTITY Data Element: CMMFDOR_CMMDTYORDREQUESTQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTQUANTITY
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTQUANTITYUNIT table field - Commodity Derivative Order Request Quantity For Filling UOM
▼
Description: Commodity Derivative Order Request Quantity For Filling UOM Field Name: CMMDTYORDERREQUESTQUANTITYUNIT Data Element: CMMFDOR_ORDREQUANTITYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTQUANTITYUNIT
|
CCMMDTYORDREQTP-CMMDTYORDREQFILLEDQUANTITY table field - Commodity Derivative Order Request Filled Quantity
▼
Description: Commodity Derivative Order Request Filled Quantity Field Name: CMMDTYORDREQFILLEDQUANTITY Data Element: CMMFDOR_ORDERREQFILLEDQUANTITY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQFILLEDQUANTITY
|
CCMMDTYORDREQTP-CMMDTYORDREQFILLEDQUANTITYUNIT table field - Filled Quantity UoM of Derivative Order Request
▼
Description: Filled Quantity UoM of Derivative Order Request Field Name: CMMDTYORDREQFILLEDQUANTITYUNIT Data Element: CMMFDOR_ORDREQFILLEDQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQFILLEDQUANTITYUNIT
|
CCMMDTYORDREQTP-CMMDTYORDREQTOBEPRICEDQTY table field - Commodity Order Request Total Quantity To Be Priced
▼
Description: Commodity Order Request Total Quantity To Be Priced Field Name: CMMDTYORDREQTOBEPRICEDQTY Data Element: CMMFDOR_CMMDTYORREQUESTOTPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOBEPRICEDQTY
|
CCMMDTYORDREQTP-CMMDTYORDREQTOBEPRICEDQTYUNIT table field - Commodity Derivative Order Request Priced Quantity UOM
▼
Description: Commodity Derivative Order Request Priced Quantity UOM Field Name: CMMDTYORDREQTOBEPRICEDQTYUNIT Data Element: CMMFDOR_ORDREQTOBEPRICEDQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOBEPRICEDQTYUNIT
|
CCMMDTYORDREQTP-CMMDTYORDREQTOBEPRICEDQTYTXT table field -
▼
Description: Field Name: CMMDTYORDREQTOBEPRICEDQTYTXT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOBEPRICEDQTYTXT
|
CCMMDTYORDREQTP-CRITICALITYCODE table field -
▼
Description: Field Name: CRITICALITYCODE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CRITICALITYCODE
|
CCMMDTYORDREQTP-CRITICALITY table field -
▼
Description: Field Name: CRITICALITY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CRITICALITY
|
CCMMDTYORDREQTP-CMMDTYORDREQTOPRICETOTQTY table field - Commodity Derivative Order Request Quantity for Pricing
▼
Description: Commodity Derivative Order Request Quantity for Pricing Field Name: CMMDTYORDREQTOPRICETOTQTY Data Element: CMMFDOR_ORDREQTOPRICETOTQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOPRICETOTQTY
|
CCMMDTYORDREQTP-CMMDTYORDREQTOPRICETOTQTYUNIT table field - Derivative Contract Specification Unit of Measure
▼
Description: Derivative Contract Specification Unit of Measure Field Name: CMMDTYORDREQTOPRICETOTQTYUNIT Data Element: CMMFDOR_ORDREQDCSUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQTOPRICETOTQTYUNIT
|
CCMMDTYORDREQTP-CMMDTYORDREQPRICEDQUANTITY table field - Commodity Derivative Order Request Priced Quantity
▼
Description: Commodity Derivative Order Request Priced Quantity Field Name: CMMDTYORDREQPRICEDQUANTITY Data Element: CMMFDOR_ORDREQPRICEDQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQPRICEDQUANTITY
|
CCMMDTYORDREQTP-CMMDTYORDREQPRICEDQUANTITYUNIT table field - Commodity Derivative Order Request Priced Quantity UOM
▼
Description: Commodity Derivative Order Request Priced Quantity UOM Field Name: CMMDTYORDREQPRICEDQUANTITYUNIT Data Element: CMMFDOR_ORDREQPRICEDQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQPRICEDQUANTITYUNIT
|
CCMMDTYORDREQTP-CMMDTYDRVTVLASTMKTPRCPERQTYTXT table field - Commodity Order Request Last Known Market Price per Qty Text
▼
Description: Commodity Order Request Last Known Market Price per Qty Text Field Name: CMMDTYDRVTVLASTMKTPRCPERQTYTXT Data Element: CMMFDOR_LASTMKTPRCPERQTYTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVLASTMKTPRCPERQTYTXT
|
CCMMDTYORDREQTP-CMMDTYLASTSPREADVALPERQTYTXT table field - Commodity Order Request Requested Spread Value per Qty Text
▼
Description: Commodity Order Request Requested Spread Value per Qty Text Field Name: CMMDTYLASTSPREADVALPERQTYTXT Data Element: CMMFDOR_LASTSPREADVALPERQTYTXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYLASTSPREADVALPERQTYTXT
|
CCMMDTYORDREQTP-CMMDTYORDREQPRCGEXECINSTRN table field - Commodity Order Request Pricing and Execution Instruction
▼
Description: Commodity Order Request Pricing and Execution Instruction Field Name: CMMDTYORDREQPRCGEXECINSTRN Data Element: CMMFDOR_ORDPRCGEXECINSTRUCTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQPRCGEXECINSTRN
|
CCMMDTYORDREQTP-CMMDTYORDREQPRCEXECINSTEXT table field - Cmmdty Drvtv Order Pricing Execution Instruction Description
▼
Description: Cmmdty Drvtv Order Pricing Execution Instruction Description Field Name: CMMDTYORDREQPRCEXECINSTEXT Data Element: CMMFDOR_ORDERPRCGEXECINSTTXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQPRCEXECINSTEXT
|
CCMMDTYORDREQTP-CMMDTYORDREQPRCGEXECINSTRNCAT table field - Pricing and Execution Instruction Category
▼
Description: Pricing and Execution Instruction Category Field Name: CMMDTYORDREQPRCGEXECINSTRNCAT Data Element: CMMFDOR_ORDPRCGEXECINSTRNCAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQPRCGEXECINSTRNCAT
|
CCMMDTYORDREQTP-CMMDTYORDREQLMTPRC table field - Commodity Derivative Order Request Limit Price
▼
Description: Commodity Derivative Order Request Limit Price Field Name: CMMDTYORDREQLMTPRC Data Element: CMMFDOR_CMMDTYORDERREQLIMPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTPRC
|
CCMMDTYORDREQTP-CMMDTYORDREQLMTPRCCURRENCY table field - Commodity Derivative Order Request Limit Price Currency
▼
Description: Commodity Derivative Order Request Limit Price Currency Field Name: CMMDTYORDREQLMTPRCCURRENCY Data Element: CMMFDOR_ORDREQLIMITPRICECRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTPRCCURRENCY
|
CCMMDTYORDREQTP-CMMDTYORDREQLMTPRCQUANTITY table field - Commodity Derivative Order Request Limit Price Quantity
▼
Description: Commodity Derivative Order Request Limit Price Quantity Field Name: CMMDTYORDREQLMTPRCQUANTITY Data Element: CMMFDOR_ORDREQLIMITPRICEQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTPRCQUANTITY
|
CCMMDTYORDREQTP-CMMDTYORDREQLMTPRCQUANTITYUNIT table field - Limit Price Quantity UoM of Order Request
▼
Description: Limit Price Quantity UoM of Order Request Field Name: CMMDTYORDREQLMTPRCQUANTITYUNIT Data Element: CMMFDOR_ORDREQLIMITPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTPRCQUANTITYUNIT
|
CCMMDTYORDREQTP-CMMDTYORDREQLMTPRCPERQTYTXT table field - Commodity Order Request Limt Price per Quantity Text
▼
Description: Commodity Order Request Limt Price per Quantity Text Field Name: CMMDTYORDREQLMTPRCPERQTYTXT Data Element: CMMFDOR_LIMITPRICEPERQTYTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTPRCPERQTYTXT
|
CCMMDTYORDREQTP-CMMDTYORDREQLMTSPREADPRC table field - Commodity Derivative Order Request Limit Spread Value
▼
Description: Commodity Derivative Order Request Limit Spread Value Field Name: CMMDTYORDREQLMTSPREADPRC Data Element: CMMFDOR_ORDREQLMTSPREADPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTSPREADPRC
|
CCMMDTYORDREQTP-CMMDTYORDREQLMTSPREADPRCCRCY table field - Commodity Order Request Limit Spread Price Currency
▼
Description: Commodity Order Request Limit Spread Price Currency Field Name: CMMDTYORDREQLMTSPREADPRCCRCY Data Element: CMMFDOR_ORDREQLMTSPREADPRCCRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTSPREADPRCCRCY
|
CCMMDTYORDREQTP-CMMDTYORDREQLMTSPREADPRCQTY table field - Limit Spread Price Quantity of Order Request
▼
Description: Limit Spread Price Quantity of Order Request Field Name: CMMDTYORDREQLMTSPREADPRCQTY Data Element: CMMFDOR_ORDREQLMTSPREADPRCQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTSPREADPRCQTY
|
CCMMDTYORDREQTP-CMMDTYORDLMTSPREADPRCQTYUNIT table field - Commodity Order Request Limit Spread Price Quantity Unit
▼
Description: Commodity Order Request Limit Spread Price Quantity Unit Field Name: CMMDTYORDLMTSPREADPRCQTYUNIT Data Element: CMMFDOR_ORDREQLMTSPRDPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDLMTSPREADPRCQTYUNIT
|
CCMMDTYORDREQTP-CMMDTYORDREQLMTSPREADPRCQTYTXT table field - Order Request Limit Spread Price per Quantity Unit
▼
Description: Order Request Limit Spread Price per Quantity Unit Field Name: CMMDTYORDREQLMTSPREADPRCQTYTXT Data Element: CMMFDOR_LMTSPREADPRCPERQTYTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLMTSPREADPRCQTYTXT
|
CCMMDTYORDREQTP-CMMDTYORDREQSTOPPRICE table field - Commodity Derivative Order Request Stop Price
▼
Description: Commodity Derivative Order Request Stop Price Field Name: CMMDTYORDREQSTOPPRICE Data Element: CMMFDOR_ORDREQSTOPPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPPRICE
|
CCMMDTYORDREQTP-CMMDTYORDREQSTOPPRICECRCY table field - Commodity Derivative Order Request Stop Price Currency
▼
Description: Commodity Derivative Order Request Stop Price Currency Field Name: CMMDTYORDREQSTOPPRICECRCY Data Element: CMMFDOR_ORDREQSTOPPRICECRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPPRICECRCY
|
CCMMDTYORDREQTP-CMMDTYORDREQSTOPPRICEQTY table field - Commodity Derivative Order Request Stop Price Quantity
▼
Description: Commodity Derivative Order Request Stop Price Quantity Field Name: CMMDTYORDREQSTOPPRICEQTY Data Element: CMMFDOR_ORDREQSTOPPRICEQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPPRICEQTY
|
CCMMDTYORDREQTP-CMMDTYORDREQSTOPPRICEQTYUNIT table field - Stop Price Quantity Unit of Measurement of Order Request
▼
Description: Stop Price Quantity Unit of Measurement of Order Request Field Name: CMMDTYORDREQSTOPPRICEQTYUNIT Data Element: CMMFDOR_ORDREQSTOPPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPPRICEQTYUNIT
|
CCMMDTYORDREQTP-CMMDTYORDREQSTOPPRICEPERQTYTXT table field - Commodity Order Request Stop Price per Quantity Text
▼
Description: Commodity Order Request Stop Price per Quantity Text Field Name: CMMDTYORDREQSTOPPRICEPERQTYTXT Data Element: CMMFDOR_STOPPRICEPERQTYTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPPRICEPERQTYTXT
|
CCMMDTYORDREQTP-CMMDTYORDREQSTOPLMTPRC table field - Commodity Derivative Order Stop Limit Price
▼
Description: Commodity Derivative Order Stop Limit Price Field Name: CMMDTYORDREQSTOPLMTPRC Data Element: CMMFDOR_ORDERSTOPLIMITPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPLMTPRC
|
CCMMDTYORDREQTP-CMMDTYORDREQSTOPLMTPRCCRCY table field - Commodity Derivative Order Request Stop Limit Price Currency
▼
Description: Commodity Derivative Order Request Stop Limit Price Currency Field Name: CMMDTYORDREQSTOPLMTPRCCRCY Data Element: CMMFDOR_ORDERSTOPLIMITPRCCRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPLMTPRCCRCY
|
CCMMDTYORDREQTP-CMMDTYORDREQSTOPLMTPRCQTY table field - Commodity Derivative Order Request Stop Limit Price Quantity
▼
Description: Commodity Derivative Order Request Stop Limit Price Quantity Field Name: CMMDTYORDREQSTOPLMTPRCQTY Data Element: CMMFDOR_ORDERSTOPLIMITPRICEQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPLMTPRCQTY
|
CCMMDTYORDREQTP-CMMDTYORDREQSTOPLMTPRCQTYUNIT table field - Commodity Derivative Order Stop Limit Price Quantity UoM
▼
Description: Commodity Derivative Order Stop Limit Price Quantity UoM Field Name: CMMDTYORDREQSTOPLMTPRCQTYUNIT Data Element: CMMFDOR_ORDERSTOPLMTPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQSTOPLMTPRCQTYUNIT
|
CCMMDTYORDREQTP-CMMDTYORDREQLEEWAYPRC table field - Commodity Derivative Order Request Requested Price
▼
Description: Commodity Derivative Order Request Requested Price Field Name: CMMDTYORDREQLEEWAYPRC Data Element: CMMFDOR_ORDREQLEEWAYPRICE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYPRC
|
CCMMDTYORDREQTP-CMMDTYORDREQLEEWAYPRCCRCY table field - Commodity Derivative Order Request Requested Price Currency
▼
Description: Commodity Derivative Order Request Requested Price Currency Field Name: CMMDTYORDREQLEEWAYPRCCRCY Data Element: CMMFDOR_ORDREQLEEWAYPRICECRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYPRCCRCY
|
CCMMDTYORDREQTP-CMMDTYORDREQLEEWAYPRCQTY table field - Commodity Derivative Order Request Requested Price Quantity
▼
Description: Commodity Derivative Order Request Requested Price Quantity Field Name: CMMDTYORDREQLEEWAYPRCQTY Data Element: CMMFDOR_ORDREQLEEWAYPRICEQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYPRCQTY
|
CCMMDTYORDREQTP-CMMDTYORDREQLEEWAYPRCQTYUNIT table field - Commodity Order Request Requested Price Quantity Unit
▼
Description: Commodity Order Request Requested Price Quantity Unit Field Name: CMMDTYORDREQLEEWAYPRCQTYUNIT Data Element: CMMFDOR_ORDREQLEEWAYPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYPRCQTYUNIT
|
CCMMDTYORDREQTP-CMMDTYORDREQLEEWAYPRCPERQTYTXT table field - Commodity Order Request Requested Price per Quantity Text
▼
Description: Commodity Order Request Requested Price per Quantity Text Field Name: CMMDTYORDREQLEEWAYPRCPERQTYTXT Data Element: CMMFDOR_LEEWAYPRICEPERQTYTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYPRCPERQTYTXT
|
CCMMDTYORDREQTP-CMMDTYORDREQLEEWAYRNGEPRC table field - Commodity Derivative Order Request Leeway Price
▼
Description: Commodity Derivative Order Request Leeway Price Field Name: CMMDTYORDREQLEEWAYRNGEPRC Data Element: CMMFDOR_ORDREQLEEWAYRNGEPRC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYRNGEPRC
|
CCMMDTYORDREQTP-CMMDTYORDREQLEEWAYRNGEPRCCRCY table field - Cmmdty Derivative Order Request Leeway Price Currency
▼
Description: Cmmdty Derivative Order Request Leeway Price Currency Field Name: CMMDTYORDREQLEEWAYRNGEPRCCRCY Data Element: CMMFDOR_ORDREQLEEWAYRNGEPRCCUR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYRNGEPRCCRCY
|
CCMMDTYORDREQTP-CMMDTYORDREQLEEWAYRNGEPRCQTY table field - Cmmdty Derivative Order Request Leeway Range Price Quantity
▼
Description: Cmmdty Derivative Order Request Leeway Range Price Quantity Field Name: CMMDTYORDREQLEEWAYRNGEPRCQTY Data Element: CMMFDOR_ORDREQLEEWAYRNGEPRCQTY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQLEEWAYRNGEPRCQTY
|
CCMMDTYORDREQTP-CMMDTYORDLEEWAYRNGEPRCQTYUNIT table field - Cmmdty Derivative Order Request Leeway Price Qty Unit
▼
Description: Cmmdty Derivative Order Request Leeway Price Qty Unit Field Name: CMMDTYORDLEEWAYRNGEPRCQTYUNIT Data Element: CMMFDOR_ORDREQLWAYRNGPRCQTYUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDLEEWAYRNGEPRCQTYUNIT
|
CCMMDTYORDREQTP-CMMDTYORDLEEWAYRNGEPRCQTYTXT table field - Commodity Order Request Leeway Price per Quantity Text
▼
Description: Commodity Order Request Leeway Price per Quantity Text Field Name: CMMDTYORDLEEWAYRNGEPRCQTYTXT Data Element: CMMFDOR_LEEWAYRNGPRCPERQTYTEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDLEEWAYRNGEPRCQTYTXT
|
CCMMDTYORDREQTP-COMMODITYORDERREQUESTTICKS table field - Commodity Order Request Ticks
▼
Description: Commodity Order Request Ticks Field Name: COMMODITYORDERREQUESTTICKS Data Element: CMMFDOR_ORDREQTICKS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERREQUESTTICKS
|
CCMMDTYORDREQTP-CMMDTYORDREQEXPRTNINSTRUCTION table field - Commodity Derivative Order Request Expiry Instruction
▼
Description: Commodity Derivative Order Request Expiry Instruction Field Name: CMMDTYORDREQEXPRTNINSTRUCTION Data Element: CMMFDOR_ORDEREXPIRATIONINST Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQEXPRTNINSTRUCTION
|
CCMMDTYORDREQTP-CMMDTYORDREQEXPINSTRNTEXT table field - Expiration Instruction Description
▼
Description: Expiration Instruction Description Field Name: CMMDTYORDREQEXPINSTRNTEXT Data Element: CMMFDOR_ORDEREXPIRATIONINSTTXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQEXPINSTRNTEXT
|
CCMMDTYORDREQTP-CMMDTYORDREQEXPRYINSTRNCAT table field - Expiration Instruction Category of Derivative Orders
▼
Description: Expiration Instruction Category of Derivative Orders Field Name: CMMDTYORDREQEXPRYINSTRNCAT Data Element: CMMFDOR_EXPIRYINSTRUCTIONCAT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQEXPRYINSTRNCAT
|
CCMMDTYORDREQTP-CMMDTYORDREQUESTEXPIRATIONDATE table field - Commodity Derivative Order Request Expiration Date
▼
Description: Commodity Derivative Order Request Expiration Date Field Name: CMMDTYORDREQUESTEXPIRATIONDATE Data Element: CMMFDOR_ORDREQEXPIRATIONDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQUESTEXPIRATIONDATE
|
CCMMDTYORDREQTP-COMMODITYSUBACCOUNTUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: COMMODITYSUBACCOUNTUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYSUBACCOUNTUUID
|
CCMMDTYORDREQTP-COMMODITYSUBACCOUNT table field - Assigned Commodity Subaccount
▼
Description: Assigned Commodity Subaccount Field Name: COMMODITYSUBACCOUNT Data Element: CMMFDOR_ASSGDSUBACCOUNTID Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: CMMFSA_SUBACCOUNTID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field COMMODITYSUBACCOUNT
|
CCMMDTYORDREQTP-COMMODITYSUBACCOUNTNAME table field - Assigned Commodity Subaccount Name
▼
Description: Assigned Commodity Subaccount Name Field Name: COMMODITYSUBACCOUNTNAME Data Element: CMMFDOR_ASSIGNEDSUBACCOUNTNAME Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: CMMFSA_SUBACCOUNTNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYSUBACCOUNTNAME
|
CCMMDTYORDREQTP-UNITOFMEASURENUMBEROFDECIMALS table field -
▼
Description: Field Name: UNITOFMEASURENUMBEROFDECIMALS Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field UNITOFMEASURENUMBEROFDECIMALS
|
CCMMDTYORDREQTP-COMMODITYDERIVATIVEBROKER table field - Comodity Derivative Broker ID
▼
Description: Comodity Derivative Broker ID Field Name: COMMODITYDERIVATIVEBROKER Data Element: CMMFDOR_BROKERID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYDERIVATIVEBROKER
|
CCMMDTYORDREQTP-BUSINESSPARTNERFULLNAME table field - Commodity Derivative Broker Name
▼
Description: Commodity Derivative Broker Name Field Name: BUSINESSPARTNERFULLNAME Data Element: CMMFDOR_BROKERNAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSPARTNERFULLNAME
|
CCMMDTYORDREQTP-COMMODITYDERIVATIVEBROKERGROUP table field - Broker Group ID
▼
Description: Broker Group ID Field Name: COMMODITYDERIVATIVEBROKERGROUP Data Element: CMMFDOR_BROKERGROUPID Data Type: length (Dec): 0(0) Check table: CMMFSA_C_BROGRP Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYDERIVATIVEBROKERGROUP
|
CCMMDTYORDREQTP-COMMODITY table field - Commodity
▼
Description: Commodity Field Name: COMMODITY Data Element: TBA_STOEFFCHEN Data Type: length (Dec): 0(0) Check table: TBAC_PHYSCOMM Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: TBAH_STOEFFCHEN SHLP Field: COMMODITY ConvExit: See all SAP tables containing field COMMODITY
|
CCMMDTYORDREQTP-CMMDTYORDSELFMATCHPREVENTIONID table field - Self-Match Prevention IDs for Commodity Deriviative Orders
▼
Description: Self-Match Prevention IDs for Commodity Deriviative Orders Field Name: CMMDTYORDSELFMATCHPREVENTIONID Data Element: CMMFDOR_ORDSELFMATCHPREVID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDSELFMATCHPREVENTIONID
|
CCMMDTYORDREQTP-CMMDTYORDMATCHPREVENTIONINSTRN table field - Commodity Order Request Self-Match Prevention Instruction
▼
Description: Commodity Order Request Self-Match Prevention Instruction Field Name: CMMDTYORDMATCHPREVENTIONINSTRN Data Element: CMMFDOR_ORDSELFMATCHPREVINSTR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDMATCHPREVENTIONINSTRN
|
CCMMDTYORDREQTP-CMMDTYORDREQUESTREFERENCEUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: CMMDTYORDREQUESTREFERENCEUUID Data Element: /BOBF/UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQUESTREFERENCEUUID
|
CCMMDTYORDREQTP-COMMODITYORDERREQUESTREFERENCE table field - Commodity Order Request Reference
▼
Description: Commodity Order Request Reference Field Name: COMMODITYORDERREQUESTREFERENCE Data Element: CMMFDOR_ORDREQREFERENCE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERREQUESTREFERENCE
|
CCMMDTYORDREQTP-CMMDTYORDREQORIGLQUANTITYINLOT table field - Commodity Derivative Order Request Quantity in Lots
▼
Description: Commodity Derivative Order Request Quantity in Lots Field Name: CMMDTYORDREQORIGLQUANTITYINLOT Data Element: CMMFDOR_ORDREQORIGNUMBEROFLOTS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQORIGLQUANTITYINLOT
|
CCMMDTYORDREQTP-CMMDTYORDERREQPREVIOUSSTATUS table field - Commodity Order Request Previous Status
▼
Description: Commodity Order Request Previous Status Field Name: CMMDTYORDERREQPREVIOUSSTATUS Data Element: CMMFDOR_ORDERREQUESTPREVSTATUS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQPREVIOUSSTATUS
|
CCMMDTYORDREQTP-CREATIONDATETIME table field - Timestamp of record creation
▼
Description: Timestamp of record creation Field Name: CREATIONDATETIME Data Element: CMMFDOR_CREATIONDATETIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATETIME
|
CCMMDTYORDREQTP-CREATIONDATEDECIMALVALUE table field - Created On
▼
Description: Created On Field Name: CREATIONDATEDECIMALVALUE Data Element: CMMFDOF_CREATEDON Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATEDECIMALVALUE
|
CCMMDTYORDREQTP-CREATEDBYUSER table field - Created By User
▼
Description: Created By User Field Name: CREATEDBYUSER Data Element: CMMFDOR_CREATEDBY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
CCMMDTYORDREQTP-CREATEDBYUSERNAME table field - Created by user name
▼
Description: Created by user name Field Name: CREATEDBYUSERNAME Data Element: CMMFSA_CREATEDBYUSERNAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSERNAME
|
CCMMDTYORDREQTP-LASTCHANGEDATETIME table field - Timestamp of last change
▼
Description: Timestamp of last change Field Name: LASTCHANGEDATETIME Data Element: CMMFDOR_LASTCHANGEDATETIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDATETIME
|
CCMMDTYORDREQTP-LASTCHANGEDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: LASTCHANGEDATE Data Element: CMMFDOF_LASTCHANGEDON Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDATE
|
CCMMDTYORDREQTP-LASTCHANGEDBYUSER table field - Last changed by user ID
▼
Description: Last changed by user ID Field Name: LASTCHANGEDBYUSER Data Element: CMMFDOR_LASTCHANGEDBYUSER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDBYUSER
|
CCMMDTYORDREQTP-LASTCHANGEDBYUSERNAME table field - Last changed by user name
▼
Description: Last changed by user name Field Name: LASTCHANGEDBYUSERNAME Data Element: CMMFSA_LASTCHANGEDBYUSERNAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDBYUSERNAME
|
CCMMDTYORDREQTP-CMMDTYORDREQUESTCANCELLATIONID table field - Commodity Order Request Cancellation ID
▼
Description: Commodity Order Request Cancellation ID Field Name: CMMDTYORDREQUESTCANCELLATIONID Data Element: CMMFDOR_ORDCANCELLATIONID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQUESTCANCELLATIONID
|
CCMMDTYORDREQTP-CMMDTYORDREQUESTCANCLNDATETIME table field - Commodity Order Request Cancellation Date Time
▼
Description: Commodity Order Request Cancellation Date Time Field Name: CMMDTYORDREQUESTCANCLNDATETIME Data Element: CMMFDOR_ORDCANCELLATIONDATTIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQUESTCANCLNDATETIME
|
CCMMDTYORDREQTP-CMMDTYORDERREQUESTCANCELEDBY table field - Commodity Order Request Cancelled By
▼
Description: Commodity Order Request Cancelled By Field Name: CMMDTYORDERREQUESTCANCELEDBY Data Element: CMMFDOR_ORDCANCELLEDBY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTCANCELEDBY
|
CCMMDTYORDREQTP-USERDESCRIPTION table field - Cancelled by user name
▼
Description: Cancelled by user name Field Name: USERDESCRIPTION Data Element: CMMFDOR_CANCELLEDBYUSERNAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field USERDESCRIPTION
|
CCMMDTYORDREQTP-INPROCESSBYUSER table field - Draft In Process By
▼
Description: Draft In Process By Field Name: INPROCESSBYUSER Data Element: SDRAFT_IN_PROCESS_BY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INPROCESSBYUSER
|
CCMMDTYORDREQTP-CMMDTYDRVTVORDTRDEXECISRECENT table field -
▼
Description: Field Name: CMMDTYDRVTVORDTRDEXECISRECENT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYDRVTVORDTRDEXECISRECENT
|