Details |
CCCMKTTP-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CCCMKTTP-CHMLCMPLNCINFOUUID table field - Chemical Compliance Information
▼
Description: Chemical Compliance Information Field Name: CHMLCMPLNCINFOUUID Data Element: EHFND_CCI_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFOUUID
|
CCCMKTTP-ACTIVECHMLCMPLNCINFOUUID table field - Chemical Compliance Information
▼
Description: Chemical Compliance Information Field Name: ACTIVECHMLCMPLNCINFOUUID Data Element: EHFND_CCI_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTIVECHMLCMPLNCINFOUUID
|
CCCMKTTP-CHMLCMPLNCINFONAVGNLINK table field - Chemical Compliance Information
▼
Description: Chemical Compliance Information Field Name: CHMLCMPLNCINFONAVGNLINK Data Element: EHFND_CCI_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFONAVGNLINK
|
CCCMKTTP-CMPLRQRSLTNAVGNLINK table field - Chemical Compliance Information
▼
Description: Chemical Compliance Information Field Name: CMPLRQRSLTNAVGNLINK Data Element: EHFND_CCI_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQRSLTNAVGNLINK
|
CCCMKTTP-MATERIAL table field - Product
▼
Description: Product Field Name: MATERIAL Data Element: EHFND_CCI_PRODUCT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIAL
|
CCCMKTTP-MATERIALNAME table field - Product Description
▼
Description: Product Description Field Name: MATERIALNAME Data Element: PRODUCTDESCRIPTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALNAME
|
CCCMKTTP-CHMLCMPLNCINFOCOMBINEDNAME table field - Product Name
▼
Description: Product Name Field Name: CHMLCMPLNCINFOCOMBINEDNAME Data Element: EHFND_CCI_PRODUCT_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFOCOMBINEDNAME
|
CCCMKTTP-CHMLCMPLNCINTERNALNAME table field - Internal Name
▼
Description: Internal Name Field Name: CHMLCMPLNCINTERNALNAME Data Element: EHFND_CCI_INTERNAL_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINTERNALNAME
|
CCCMKTTP-NMBROFCHMLCMPLNCREQOPN table field -
▼
Description: Field Name: NMBROFCHMLCMPLNCREQOPN Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCHMLCMPLNCREQOPN
|
CCCMKTTP-NMBROFCHMLCMPLNCPCKGDPRODUCTS table field - Packaged Products
▼
Description: Packaged Products Field Name: NMBROFCHMLCMPLNCPCKGDPRODUCTS Data Element: EHPMA_NUMBER_OF_PP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCHMLCMPLNCPCKGDPRODUCTS
|
CCCMKTTP-NMBROFCHMLCMPLNCREQOPNWITHTOT table field - Pending Market Requests
▼
Description: Pending Market Requests Field Name: NMBROFCHMLCMPLNCREQOPNWITHTOT Data Element: EHPMA_NUMBER_OF_OPEN_REQ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCHMLCMPLNCREQOPNWITHTOT
|
CCCMKTTP-CHMLCMPLNCAPPLICATION table field - Applications
▼
Description: Applications Field Name: CHMLCMPLNCAPPLICATION Data Element: EHPMA_APPLICATION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCAPPLICATION
|
CCCMKTTP-NMBROFCHMLCMPLNCMKTCOUNTRIES table field - Countries
▼
Description: Countries Field Name: NMBROFCHMLCMPLNCMKTCOUNTRIES Data Element: EHPMA_NUMBER_OF_COUNTRIES Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCHMLCMPLNCMKTCOUNTRIES
|
CCCMKTTP-NMBROFCHMLCMPLNCREQPROCD table field - Covered Market Requests
▼
Description: Covered Market Requests Field Name: NMBROFCHMLCMPLNCREQPROCD Data Element: EHPMA_NUMBER_OF_COV_REQ Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCHMLCMPLNCREQPROCD
|
CCCMKTTP-NMBROFINPROCESSCMPLRQRSLTS table field - Number of Compliance Requirement Results 'In Progress'
▼
Description: Number of Compliance Requirement Results 'In Progress' Field Name: NMBROFINPROCESSCMPLRQRSLTS Data Element: EHFND_CCI_NUMBER_OF_CRR_IP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFINPROCESSCMPLRQRSLTS
|
CCCMKTTP-NMBROFRELEASEDCMPLRQRSLTS table field - Number of Released Compliance Requirement Results
▼
Description: Number of Released Compliance Requirement Results Field Name: NMBROFRELEASEDCMPLRQRSLTS Data Element: EHFND_CCI_NUMBER_OF_CRR_RE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFRELEASEDCMPLRQRSLTS
|
CCCMKTTP-NMBROFCMPLRQRSLTS table field - Number of Compliance Requirement Results
▼
Description: Number of Compliance Requirement Results Field Name: NMBROFCMPLRQRSLTS Data Element: EHFND_CCI_NUMBER_OF_CRR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NMBROFCMPLRQRSLTS
|
CCCMKTTP-RELEASEDCMPLRQRSLTSCRITLTY table field -
▼
Description: Field Name: RELEASEDCMPLRQRSLTSCRITLTY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RELEASEDCMPLRQRSLTSCRITLTY
|
CCCMKTTP-RELEASEDCMPLRQRSLTSPCTNAME table field - Number of Released Compliance Requirement Results
▼
Description: Number of Released Compliance Requirement Results Field Name: RELEASEDCMPLRQRSLTSPCTNAME Data Element: EHFND_CCI_CRR_RE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RELEASEDCMPLRQRSLTSPCTNAME
|
CCCMKTTP-RELEASEDCMPLRQRSLTSPCT table field -
▼
Description: Field Name: RELEASEDCMPLRQRSLTSPCT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RELEASEDCMPLRQRSLTSPCT
|
CCCMKTTP-INPROCESSCMPLRQRSLTSCRITLTY table field -
▼
Description: Field Name: INPROCESSCMPLRQRSLTSCRITLTY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INPROCESSCMPLRQRSLTSCRITLTY
|
CCCMKTTP-INPROCESSCMPLRQRSLTSPCTNAME table field - Number of Compliance Requirement Results 'In Progress'
▼
Description: Number of Compliance Requirement Results 'In Progress' Field Name: INPROCESSCMPLRQRSLTSPCTNAME Data Element: EHFND_CCI_CRR_IP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INPROCESSCMPLRQRSLTSPCTNAME
|
CCCMKTTP-INPROCESSCMPLRQRSLTSPCT table field -
▼
Description: Field Name: INPROCESSCMPLRQRSLTSPCT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INPROCESSCMPLRQRSLTSPCT
|
CCCMKTTP-SPECIFICATION table field - Internal Number
▼
Description: Internal Number Field Name: SPECIFICATION Data Element: EHFND_INTERNAL_NR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SPECIFICATION
|
CCCMKTTP-PRODSTEWARDSHIPRESPUNIT table field - Responsible Unit
▼
Description: Responsible Unit Field Name: PRODSTEWARDSHIPRESPUNIT Data Element: EHFND_CCI_RESPONSIBLE_UNIT_PSS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PRODSTEWARDSHIPRESPUNIT
|
CCCMKTTP-RESPONSIBLEUNITNAME table field - Description of Responsible Unit
▼
Description: Description of Responsible Unit Field Name: RESPONSIBLEUNITNAME Data Element: EHFND_CCI_RESPONSIBLE_UNIT_DSC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RESPONSIBLEUNITNAME
|
CCCMKTTP-DNGRSGDSRESPUNIT table field - Responsible Unit for Dangerous Goods
▼
Description: Responsible Unit for Dangerous Goods Field Name: DNGRSGDSRESPUNIT Data Element: EHFND_CCI_RESPONSIBLE_UNIT_DG Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DNGRSGDSRESPUNIT
|
CCCMKTTP-DNGRSGDSRESPUNITNAME table field - Responsible Unit for Dangerous Goods Name
▼
Description: Responsible Unit for Dangerous Goods Name Field Name: DNGRSGDSRESPUNITNAME Data Element: EHFND_DG_RESPONSIBLE_UNIT_DSC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DNGRSGDSRESPUNITNAME
|
CCCMKTTP-CHMLCMPLNCINFOTYPE table field - CCI Type
▼
Description: CCI Type Field Name: CHMLCMPLNCINFOTYPE Data Element: EHFND_CCI_TYPE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFOTYPE
|
CCCMKTTP-MATERIALISTRANSPORTED table field - Product is Transported
▼
Description: Product is Transported Field Name: MATERIALISTRANSPORTED Data Element: EHFND_CCI_IS_TRANSPORTED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISTRANSPORTED
|
CCCMKTTP-MATERIALISSOLD table field - Product is Sold
▼
Description: Product is Sold Field Name: MATERIALISSOLD Data Element: EHFND_CCI_IS_SOLD Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISSOLD
|
CCCMKTTP-MATERIALISPRODUCED table field - Product is Produced
▼
Description: Product is Produced Field Name: MATERIALISPRODUCED Data Element: EHFND_CCI_IS_PRODUCED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISPRODUCED
|
CCCMKTTP-MATERIALISSOURCED table field - Product is Sourced
▼
Description: Product is Sourced Field Name: MATERIALISSOURCED Data Element: EHFND_CCI_IS_SOURCED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALISSOURCED
|
CCCMKTTP-CHMLCMPLNCPRODISRESEARCHED table field - Research and Development Sample
▼
Description: Research and Development Sample Field Name: CHMLCMPLNCPRODISRESEARCHED Data Element: EHFND_CCI_IS_RESEARCHED Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCPRODISRESEARCHED
|
CCCMKTTP-LASTCHANGEUTCDATETIME table field - Last Changed On
▼
Description: Last Changed On Field Name: LASTCHANGEUTCDATETIME Data Element: EHFND_BO_LCHG_DATE_TIME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEUTCDATETIME
|
CCCMKTTP-LASTCHANGEDBYUSER table field - Last Change By
▼
Description: Last Change By Field Name: LASTCHANGEDBYUSER Data Element: EHFND_BO_LCHG_UNAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDBYUSER
|
CCCMKTTP-USERDESCRIPTION table field - User Description
▼
Description: User Description Field Name: USERDESCRIPTION Data Element: VDM_USERDESCRIPTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field USERDESCRIPTION
|