Details |
CCCMKTCRR-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CCCMKTCRR-COUNTRY table field -
▼
Description: Field Name: COUNTRY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COUNTRY
|
CCCMKTCRR-CHMLCMPLNCINFOUUID table field - Chemical Compliance Information
▼
Description: Chemical Compliance Information Field Name: CHMLCMPLNCINFOUUID Data Element: EHFND_CCI_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFOUUID
|
CCCMKTCRR-CMPLRQVERSUUID table field - Compliance Requirement UUID
▼
Description: Compliance Requirement UUID Field Name: CMPLRQVERSUUID Data Element: EHFND_CRV_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQVERSUUID
|
CCCMKTCRR-CHMLCMPLNCPRODUUID table field - Chemical Compliance Information
▼
Description: Chemical Compliance Information Field Name: CHMLCMPLNCPRODUUID Data Element: EHFND_CCI_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCPRODUUID
|
CCCMKTCRR-CMPLRQVERSNAME table field - Compliance Requirement Name
▼
Description: Compliance Requirement Name Field Name: CMPLRQVERSNAME Data Element: EHFND_CRR_CRV_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQVERSNAME
|
CCCMKTCRR-CMPLRQVERS table field - Compliance Requirement Name
▼
Description: Compliance Requirement Name Field Name: CMPLRQVERS Data Element: EHFND_CRV_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQVERS
|
CCCMKTCRR-CMPLRQVERSENGLISHNAME table field - Compliance Requirement Name
▼
Description: Compliance Requirement Name Field Name: CMPLRQVERSENGLISHNAME Data Element: EHFND_CRV_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQVERSENGLISHNAME
|
CCCMKTCRR-COMPLIANCEREQUIREMENT table field - Compliance Requirement
▼
Description: Compliance Requirement Field Name: COMPLIANCEREQUIREMENT Data Element: EHFND_REQ_IDENTIFIER Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: EHFND_ELM_REQ_IDENTIFIER SHLP Field: COMPLIANCEREQUIREMENT ConvExit: See all SAP tables containing field COMPLIANCEREQUIREMENT
|
CCCMKTCRR-CMPLRQPATTERN table field -
▼
Description: Field Name: CMPLRQPATTERN Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQPATTERN
|
CCCMKTCRR-CMPLRQRSLTNAVGNLINK table field - Released Compliance Assessment UUID
▼
Description: Released Compliance Assessment UUID Field Name: CMPLRQRSLTNAVGNLINK Data Element: EHFND_CRR_RELD_UUID Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQRSLTNAVGNLINK
|
CCCMKTCRR-CHMLCMPLNCINFOCOMBINEDNAME table field - Assigned to Packaged Product
▼
Description: Assigned to Packaged Product Field Name: CHMLCMPLNCINFOCOMBINEDNAME Data Element: EHPMA_PACKAGED_PRODUCT_DSC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINFOCOMBINEDNAME
|
CCCMKTCRR-MATERIALNAME table field - Product Description
▼
Description: Product Description Field Name: MATERIALNAME Data Element: PRODUCTDESCRIPTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALNAME
|
CCCMKTCRR-CHMLCMPLNCINTERNALNAME table field - Internal Name
▼
Description: Internal Name Field Name: CHMLCMPLNCINTERNALNAME Data Element: EHFND_CCI_INTERNAL_NAME Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHMLCMPLNCINTERNALNAME
|
CCCMKTCRR-MATERIAL table field - Product
▼
Description: Product Field Name: MATERIAL Data Element: EHFND_CCI_PRODUCT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIAL
|
CCCMKTCRR-CMPLRQRSLTRELDCMPLNCSTS table field - Marketability Status
▼
Description: Marketability Status Field Name: CMPLRQRSLTRELDCMPLNCSTS Data Element: EHPMA_CRR_MKT_STATUS Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: EHFND_CRR_COMPSTAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQRSLTRELDCMPLNCSTS
|
CCCMKTCRR-CMPLRQRSLTCMPLNCSTS table field - Marketability Status
▼
Description: Marketability Status Field Name: CMPLRQRSLTCMPLNCSTS Data Element: EHPMA_CRR_MKT_STATUS Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: EHFND_CRR_COMPSTAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQRSLTCMPLNCSTS
|
CCCMKTCRR-CMPLRQRSLTRELDCMPLNCSTSTXT table field - Compliance Status
▼
Description: Compliance Status Field Name: CMPLRQRSLTRELDCMPLNCSTSTXT Data Element: EHFND_CRR_COMPL_STAT_TEXT Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQRSLTRELDCMPLNCSTSTXT
|
CCCMKTCRR-RELDCMPLNCSTSFORSORTING table field - 1 Byte Unsigned Integer
▼
Description: 1 Byte Unsigned Integer Field Name: RELDCMPLNCSTSFORSORTING Data Element: INT1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RELDCMPLNCSTSFORSORTING
|
CCCMKTCRR-CMPLRQRSLTCMPLNCSTSCRITICALITY table field - 1 Byte Unsigned Integer
▼
Description: 1 Byte Unsigned Integer Field Name: CMPLRQRSLTCMPLNCSTSCRITICALITY Data Element: INT1 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQRSLTCMPLNCSTSCRITICALITY
|
CCCMKTCRR-RELEASEDATE table field - Release Date
▼
Description: Release Date Field Name: RELEASEDATE Data Element: EHFND_RELEASE_DATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RELEASEDATE
|
CCCMKTCRR-RELEASEDBYUSER table field - Released By
▼
Description: Released By Field Name: RELEASEDBYUSER Data Element: EHFND_CRR_RELEASED_BY_USER_BP Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RELEASEDBYUSER
|
CCCMKTCRR-CMPLRQRSLTPROCESSORNAME table field - Description of the Technical User Account
▼
Description: Description of the Technical User Account Field Name: CMPLRQRSLTPROCESSORNAME Data Element: SUIDTECHDESC Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQRSLTPROCESSORNAME
|
CCCMKTCRR-CMPLRQRSLTHASINPROGRESSVERSION table field - Indicator: Compliance Requirement Has a Version in Progress
▼
Description: Indicator: Compliance Requirement Has a Version in Progress Field Name: CMPLRQRSLTHASINPROGRESSVERSION Data Element: EHFND_CRR_HAS_PRELIM_VERSION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMPLRQRSLTHASINPROGRESSVERSION
|